You Searched For: Hytest Ltd


2,094  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"2094"
Description: HBD-1, B-Defensin-1, human, Purity: HPLC >/- 95%, Molecular Weight: 3929.6, Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGACC, This is a 3.9kDa 36-amino acid peptide called beta-Defensin-1 having a beta sheet with three intramolecular disulfide bonds, Size: 0.1 mg
Catalog Number: 103003-364
Supplier: Anaspec Inc


Description: Anti-BetaGamma (MPS-Phosducin-like protein C terminus), Purity: HPLC >/= 95%, Molecular Weight: 4601.4, Sequence: AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE, Appearance: Lyophilized white powder, This is a membrane-permeable phosphoducin-like anti-BY peptide, Size: 0.5 mg
Catalog Number: 102996-462
Supplier: Anaspec Inc


Description: SensoLyte* 520 MMP-9 Assay Kit *Fluorimetric*, Components: MMP-9 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability
Catalog Number: 103010-240
Supplier: Anaspec Inc


Description: ACTH (1-17), Purity: HPLC >/- 95%, Molecular Weight: 2093.4, Sequence: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH, Appearance: Powder, ACTH (1–17), and aMSH, both derived from POMC are involved in melanogenesis, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-356
Supplier: Anaspec Inc


Description: T20 36-residue peptide corresponds to aa 643-678 of the C-terminus of HIV-1LAIgp41. It strongly inhibits HIV-1 viral fusion with an EC50 of 1 ng/ml, Purity: HPLC>/=95%, Sequence (One-Letter Code): Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2, Molecular weight: 4492, Size: 1 mg
Catalog Number: 103006-446
Supplier: Anaspec Inc


Description: [Leu5]-Enkephalin, Purity: HPLC >/= 95%, Molecular Weight: 555.7, Sequence: H-Tyr-Gly-Gly-Phe-Leu-OH, Appearance: Solid, Storage: -20 deg C, Size: 25 mg
Catalog Number: 102996-548
Supplier: Anaspec Inc


Description: Chicken OVA-Q4H7 Peptide
Catalog Number: 103008-066
Supplier: Anaspec Inc


Description: S2238, Thrombin Substrate, Sequence: f-Pip-R-pNA, Purity: By HPLC greater than or equal to 95%, This is a chromogenic substrate for thrombin, Abs=405 nm, Molecular Weight: 552.6, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-720
Supplier: Anaspec Inc


Description: Angiotensin I, human, Purity: HPLC >/= 95%, Molecular Weight: 1296.5, Sequence: H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH, Appearance: Lyophilized white powder, This Angiotensin I sequence also corresponds to horse, sheep, pig, and rat Ang I, Storage: -20 deg C, Size: 25 mg
Catalog Number: 102996-062
Supplier: Anaspec Inc


Description: Recombinant human A-Synuclein (1-140), biotin labeled, Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE and mass spectrometry, expressed and purified from E. Coli and conjugated with biotin, Storage: -80 degree C, Size: 200ug
Catalog Number: 103001-712
Supplier: Anaspec Inc


Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-406
Supplier: Anaspec Inc


Description: HiLyte* Fluor 594 acid, SE, Synonym: HiLyte* Fluor 594 acid, NHS ester, an alternative to Alexa Fluor* 594 and DyLight Fluor* 594, Molecular Weight 848.94, Spectral Properties: Abs/Em = 593/616 nm, Solvent System: DMF/DMSO, Storage: -20 deg C, Form: Solid, Size: 1 mg
Catalog Number: 103010-956
Supplier: Anaspec Inc


Description: [Leu31, Pro34]-Neuropeptide Y, human, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4240.8, Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2Like neuropeptide Y and other peptides of the family, this peptide adopts a folded hairpin structure, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-554
Supplier: Anaspec Inc


Description: Biotin-TAT (47-57), HIV-derived cell penetrating TAT peptide, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): Biotin-YGRKKRRQRRR, Molecular Weight: 1786.2, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-416
Supplier: Anaspec Inc


Description: [Ala13] - Apelin - 13 (QRPRLSHKGPMPA), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Ala - OH, MW: 1474.7, Physical State: White Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-336
Supplier: Anaspec Inc


Description: Beta-Amyloid (1-28), Human, Purity: HPLC >/= to 95%, Molecular Weight: 3262.5, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK, The three-dimensional solution structure of AB (1-28) reveals the folding of the peptide, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102996-488
Supplier: Anaspec Inc


689 - 704 of 2,094