You Searched For: Hytest Ltd

Description: B8R (20-27), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 960.1, Sequence: TSYKFESV, amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-426

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)27, Lys(Me1)36]-Histone H3 (21-44)-GK, H3K27(Me2)K36(Me1), Purity: HPLC >/= 95%, MW: 2959.5, Sequence: [ATKAAR-K(Me2)-SAPATGGV-K(Me1)-KPHRYRPGG-K(Biotin)], biotin - labeled, Appearance: Off white solid, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-918

Supplier: Anaspec Inc

Sale

Description: Glucagon-Like Peptide 1, GLP-1 (7-37), Purity: HPLC >/= to 95%, Molecular Weight: 3355.7, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-116

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)382]-p53 (372-389), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2473, Sequence: Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG, Label: Biotin, derived from amino acid residues 372-389 of p53 tumor suppressor protein, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-518

Supplier: Anaspec Inc

Sale

Description: Recombinant human MOG (1 - 125), Source: E.Coli, Purity: Greater than 95% as determined by SDS-PAGE, Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL) assay, Storage: 2-4 degree Celcius, Size: 500ug

Catalog Number: 102998-100

Supplier: Anaspec Inc

Sale

Description: DiSC3(5), Synonym: 3,3'-Dipropylthiadicarbocyanine iodide, Accumulate in cells on hyperpolarized membranes, Molecular Weight: 546.5, Spectral Properties: Abs/Em = 651/675 nm, Solvent System: DMSO, CAS number: 53213-94-8, Molecular formula: C25H27IN2S2, Storage -20C, Size: 100 mg

Catalog Number: 103011-276

Supplier: Anaspec Inc

Sale

Description: Calcitonin Gene Related Peptide, CGRP, human, Purity: HPLC >/= to 95%, Molecular Weight: 3789.4, Sequence: ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2, Appearance: Lyophilized white powder, is a 37-amino acid neuropeptide, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-084

Supplier: Anaspec Inc

Sale

Description: 5(6)-FAM [[5-(and-6)-Carboxyfluorescein] *UltraPure Grade* *Mixed Isomers*], Purity: >90% purity HPLC, Molecular Formula: C21H12O7, Molecular Weight: 376.32, Appearance: Orange solid, Solvent System DMF or DMSO, used to prepare fluoresceinated bioconjugates, size: 10 g

Catalog Number: 103010-750

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2, Molecular weight: 4683.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103006-504

Supplier: Anaspec Inc

Sale

Description: 5-TAMRA Lysine, Synonym: Tetramethylrhodamine-5-carboxamide lysine, building block and a good transglutaminase substrate, Molecular Weight: 558.62, Spectral Properties: Abs/Em = 545/575 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103011-034

Supplier: Anaspec Inc

Sale

Description: 6-HEX, SE, Synonym: 6-carboxy-2',4,4',5',7,7'-hexachlorofluorescein, succinimidyl ester; 6-HEX, NHS ester, amino-reactive fluorescent probe widely used in nucleic acid sequencing, MW: 680.06, Spectral Properties: Abs/Em = 533/550 nm, Solvent System: DMF or DMSO, Size: 5 mg

Catalog Number: 103010-794

Supplier: Anaspec Inc

Sale

Description: SensoLyte* NADP/NADPH Assay Kit *Colorimetric*, Components: Reagent A 180 uL, Reagent B 80 uL, Assay Buffer 50 mL, Enzyme Cycling Mix 80 uL, NADP Standard 1.5 mM, 20 uL, NADP Extraction Buffer 25 mL, NADPH Extraction Buffer 25 mL, Stop solution 20 mL

Catalog Number: 103010-618

Supplier: Anaspec Inc

Sale

Description: C3a (70 - 77) (ASHLGLAR), octapeptide & COOH-terminal fragment, Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Ala - Ser - His - Leu - Gly - Leu - Ala - Arg - OH, Molecular Weight: 823.9, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-356

Supplier: Anaspec Inc

Sale

Description: Kisspeptin-10 (Kp-10), Metastin (110-119), mouse, rat, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1318.5, Sequence: YNWNSFGLRY-NH2, amidated peptide sequence is found in C-terminal 110 to 119, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-422

Supplier: Anaspec Inc

Sale

Description: Pep-1-Cysteamine, Sequence: Ac-KETWWETWWTEWSQPKKKRKV-cysteamine, Purity: By HPLC >/= 95%, used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive way, Molecular Weight: 2950.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-778

Supplier: Anaspec Inc

Sale

Description: Alpha9-Gliadin (57-68), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1455.7, Sequence: QLQPFPQPQLPY, derived from amino acid 57-68 of a9-gliadin and represents an immunodominant epitope, resistant to pancreatic proteolysis, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-718

Supplier: Anaspec Inc

Sale