You Searched For: Hytest Ltd

Description: EndoFree Recombinant Human alpha-Synuclein Protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, Thioflavin T assay, Application: Fibrillation, oligomerization, cell toxicity studies, Storage: 2-4 degree C, Size: 1000ug

Catalog Number: 103001-644

Supplier: Anaspec Inc

Sale

Description: 5(6) - CFDA, SE, Synonym: 5 - (and - 6) - Carboxyfluorescein diacetate, succinimidyl ester Mixed Isomers; 5(6) - CFDA, NHS ester, Reactive pH indicator for slightly acidic pH range, MW: 557.5, Spectral Properties: Abs/Em = 492/517 nm, Solvent System: DMSO, Size: 25 mg

Catalog Number: 103011-388

Supplier: Anaspec Inc

Sale

Description: Indo-1, AM, Emission-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration, Molecular Weight: 1009.9, Spectral Properties: Abs/Em = 346/475 nm, Solvent System: DMSO, Molecular Formula: C47H51N3O22C47H51N3O22, CAS number: 112926-02-0, Size: 1 mg

Catalog Number: 103011-166

Supplier: Anaspec Inc

Sale

Description: Listeria monocytogenes Listeriolysin O; LLO (91-99), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1058.1, Sequence: GYKDGNEYI, peptide is the H2-Kd-restricted epitope of Listeriolysin O (LLO), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-564

Supplier: Anaspec Inc

Sale

Description: Thrombin Receptor Agonist (FLLRN), Purity: HPLC >/- 95%, Molecular Weight: 661.8, Sequence: H-Phe-Leu-Leu-Arg-Asn-OH, Appearance: Powder, This thrombin receptor agonist peptide is a PAR 1 antagonist peptide, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-342

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 440 Cathepsin B Assay Kit *Fluorimetric*, Components: Cathepsin B substrate 1 mM, 50 ul, AMC 1 mM, 10 uL, Cathepsin B enzyme 5 uL, Assay Buffer 20 mL, Cathepsin B inhibitor Ac-LVK-CHO 100 uM, 10 uL, DTT 1 M, 100 uL, storage: -20 deg C

Catalog Number: 103010-534

Supplier: Anaspec Inc

Sale

Description: Recombinant Human Tau (Tau-441) Protein, GST tagged at the N-terminal, Microtubule associated protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, 71.8 kDa, Application: In vitro phosphorylation, Storage: 2-4 degree C, Size: 50ug

Catalog Number: 103001-726

Supplier: Anaspec Inc

Sale

Description: EndoFree Recombinant Human alpha-Synuclein Protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, Thioflavin T assay, Application: Fibrillation, oligomerization, cell toxicity studies, Storage: 2-4 degree C, Size: 500ug

Catalog Number: 103001-646

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid Peptide (1-40), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4233.8, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-660

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 FRET SIRT1 Assay Kit *Fluorimetric*, Components: SIRT1 520 FRET substrate 1 mM, 50 ul, Deacetylated FRET 1 mM, 20 ul, SIRT1, Human Recom 0.1 mg/mL, 100 ul, Assay Buffer 20 mL, NAD+ 20 mM, 100 ul, Nicotinamide 30 m?, 0.5 mL, SIRT1 Developer 0.5 mL

Catalog Number: 103010-514

Supplier: Anaspec Inc

Sale

Description: EA (52-68), class II MHC EA chain (EA) (52-68) peptide (AbBEp). It occupies about 10% of natural Iab, Purity: HPLC >/=95%, Sequence (One-Letter Code): ASFEAQGALANIAVDKA, Molecular weight: 1675.9, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-882

Supplier: Anaspec Inc

Sale

Description: 5(6)-FAM [[5-(and-6)-Carboxyfluorescein] *UltraPure Grade* *Mixed Isomers*], Purity: >90% purity HPLC, Molecular Formula: C21H12O7, Molecular Weight: 376.32, Appearance: Orange solid, Solvent System DMF or DMSO, used to prepare fluoresceinated bioconjugates, size: 1 g

Catalog Number: 103010-748

Supplier: Anaspec Inc

Sale

Description: ?-Calcitonin Gene Related Peptide, A-CGRP, rat, Purity: HPLC >/- 95%, Molecular Weight: 3806.3, Sequence: SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2, Appearance: Powder, is preferentially expressed in sensory neuron, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-360

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-2, PAR-2 Agonist, amide MW: 778, Sequence: 2-Furoyl-LIGRLO-NH2] The peptide 2-furoyl-LIGRLO-NH2 showed higher potency and receptor selectivity, Apperance: Off white solid, Store: -20 deg C, Size: 1mg

Catalog Number: 103010-024

Supplier: Anaspec Inc

Sale

Description: Fibrinogen Binding Inhibitor Peptide, Purity: HPLC >/- 95%, Molecular Weight: 1190.3, Sequence: H-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val-OH, is important for platelet aggregation, The sequence is derived from the carboxy terminus, Size: 1 mg

Catalog Number: 103003-350

Supplier: Anaspec Inc

Sale

Description: Histone H1-derived Peptide, phosphorylated by protein kinase A, substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): GGGPATPKKAKKL, MW: 1252.5, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-968

Supplier: Anaspec Inc

Sale