You Searched For: Hytest Ltd

Description: Histone H4 (8-30)-WGK

Catalog Number: 103009-604

Supplier: Anaspec Inc

Sale

Description: Human [Lys(Ac)382]-p53 (361-393), Biotin, AnaSpec

Catalog Number: 103008-518

Supplier: Anaspec Inc

Sale

Description: Human [FAM-Trp31]-GLP-1 (7-36), Fluorescent label at Trp31, FAM (Carboxyfluorescein)

Catalog Number: 103008-200

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 11), Human, DAEFRHDSGYE, Purity: Peak Area By HPLC greater than or equal to 95%, Physical State: Solid, Molecular Weight: 1325.3, Storage: -20 deg C, size: 1mg

Catalog Number: 102999-348

Supplier: Anaspec Inc

Sale

Description: Histone H1-derived Peptide, phosphorylated by protein kinase A, substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): GGGPATPKKAKKL, MW: 1252.5, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-968

Supplier: Anaspec Inc

Sale

Description: Fibrinogen Binding Inhibitor Peptide, Purity: HPLC >/- 95%, Molecular Weight: 1190.3, Sequence: H-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val-OH, is important for platelet aggregation, The sequence is derived from the carboxy terminus, Size: 1 mg

Catalog Number: 103003-350

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 440 Cathepsin B Assay Kit *Fluorimetric*, Components: Cathepsin B substrate 1 mM, 50 ul, AMC 1 mM, 10 uL, Cathepsin B enzyme 5 uL, Assay Buffer 20 mL, Cathepsin B inhibitor Ac-LVK-CHO 100 uM, 10 uL, DTT 1 M, 100 uL, storage: -20 deg C

Catalog Number: 103010-534

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Glutathione Cellular Assay Kit *Fluorimetric*, Components: GSH detection reagent 1 vial, Reduced Glutathione standard 10 mM, 100 uL, Assay Buffer 50 mL, GST enzyme 50U/mL, 200 uL, GST enzyme 50U/mL, 200 uL, storage: -20 deg C

Catalog Number: 103010-520

Supplier: Anaspec Inc

Sale

Description: Recombinant Human Tau (Tau-441) Protein, GST tagged at the N-terminal, Microtubule associated protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, 71.8 kDa, Application: In vitro phosphorylation, Storage: 2-4 degree C, Size: 50ug

Catalog Number: 103001-726

Supplier: Anaspec Inc

Sale

Description: PKTPKKAKKL, Purity: Greater than or equal to 95%(HPLC), Molecular weight: 1138.5, Sequence: H-Pro-Lys-Thr-Pro-Lys-Lys-Ala-Lys-Lys-Leu-OH (3-letter code), derived from histone H1 peptide sequence, It is an effective CDK5 substrate (Km = 40 uM), Storage: At -20 Degree C, Size: 1mg

Catalog Number: 103002-946

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 40) - Lys(Biotin - LC), Human, Purity: HPLC >/- 95%, Molecular Weight: 4797.5, Appearance: Lyophilized white powder, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K, contains a 6-carbon long chain, size: 0.5 mg

Catalog Number: 103003-544

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 750 acid, SE, longest-wavelength amine-reactive, Spectrally similar to Cy7 dye, MW: 1328.75, Spectral Properties: Abs/Em = 754/778 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Store away from oxidizing agent, Size: 1 mg

Catalog Number: 103010-946

Supplier: Anaspec Inc

Sale

Description: CKS-17 (dimer), MN10021, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4088.8, Sequence: LQNRRGLDLLFLKEGGLC (dimer), dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (cysteine-disulfide linkage), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-252

Supplier: Anaspec Inc

Sale

Description: GRGDS, amide (GRGDS - NH2), Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code: H - Gly - Arg - Gly - Asp - Ser - NH2, Molecular Weight: 489.5, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg

Catalog Number: 103006-346

Supplier: Anaspec Inc

Sale

Description: S6 Kinase Substrate (229 - 239), Purity: HPLC >/= 95%, Molecular Weight: 1313.6, Sequence: H-Ala-Lys-Arg-Arg-Arg-Leu-Ser-Ser-Leu-Arg-Ala-OH, Appearance: Lyophilized white powder, This is a synthetic peptide substrate for S6 kinase, Size: 5 mg

Catalog Number: 102996-886

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid Peptide (1-40), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4233.8, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-660

Supplier: Anaspec Inc

Sale