2,094  results were found

SearchResultCount:"2094"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103008-422)
Supplier: Anaspec Inc
Description: Kisspeptin-10 (Kp-10), Metastin (110-119), mouse, rat, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1318.5, Sequence: YNWNSFGLRY-NH2, amidated peptide sequence is found in C-terminal 110 to 119, Storage: -20 degree C, Size: 1mg


Catalog Number: (103007-778)
Supplier: Anaspec Inc
Description: Pep-1-Cysteamine, Sequence: Ac-KETWWETWWTEWSQPKKKRKV-cysteamine, Purity: By HPLC >/= 95%, used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive way, Molecular Weight: 2950.3, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103011-314)
Supplier: Anaspec Inc
Description: Resorufin B - D - Galactopyranoside, for sensitive enzyme measurements in ELISA, by flow cytometry and to detect immobilized B-galactosidase activity, Molecular Weight: 375.33, Spectral Properties: Abs/Em = 573/585 nm, Solvent System: DMSO, Size: 25 mg


Catalog Number: (103008-718)
Supplier: Anaspec Inc
Description: Alpha9-Gliadin (57-68), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1455.7, Sequence: QLQPFPQPQLPY, derived from amino acid 57-68 of a9-gliadin and represents an immunodominant epitope, resistant to pancreatic proteolysis, Storage: -20 deg C, Size: 1mg


Catalog Number: (103011-326)
Supplier: Anaspec Inc
Description: Dihydroethidium, Synonym: Hydroethidine, Bind to DNA/RNA (red fluorescence) upon oxidation, MW: 315.4, Spectral Properties: Abs/Em = 518/605 nm (after oxidation), Solvent System: DMSO, form: Dark red, pink Solid, Storage: -20C desiccated and protected from light, Size: 25 mg


Catalog Number: (103010-752)
Supplier: Anaspec Inc
Description: 5(6)-FAM [[5-(and-6)-Carboxyfluorescein] *UltraPure Grade* *Mixed Isomers*], Purity: >90% purity HPLC, Molecular Formula: C21H12O7, Molecular Weight: 376.32, Appearance: Orange solid, Solvent System DMF or DMSO, used to prepare fluoresceinated bioconjugates, size: 25 g


Catalog Number: (103010-946)
Supplier: Anaspec Inc
Description: HiLyte* Fluor 750 acid, SE, longest-wavelength amine-reactive, Spectrally similar to Cy7 dye, MW: 1328.75, Spectral Properties: Abs/Em = 754/778 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Store away from oxidizing agent, Size: 1 mg


Catalog Number: (103006-968)
Supplier: Anaspec Inc
Description: Histone H1-derived Peptide, phosphorylated by protein kinase A, substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): GGGPATPKKAKKL, MW: 1252.5, Storage: -20 degree C, Size: 1 mg


Catalog Number: (102999-348)
Supplier: Anaspec Inc
Description: Beta - Amyloid (1 - 11), Human, DAEFRHDSGYE, Purity: Peak Area By HPLC greater than or equal to 95%, Physical State: Solid, Molecular Weight: 1325.3, Storage: -20 deg C, size: 1mg


Catalog Number: (103003-544)
Supplier: Anaspec Inc
Description: Beta - Amyloid (1 - 40) - Lys(Biotin - LC), Human, Purity: HPLC >/- 95%, Molecular Weight: 4797.5, Appearance: Lyophilized white powder, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K, contains a 6-carbon long chain, size: 0.5 mg


Catalog Number: (103010-520)
Supplier: Anaspec Inc
Description: SensoLyte* Glutathione Cellular Assay Kit *Fluorimetric*, Components: GSH detection reagent 1 vial, Reduced Glutathione standard 10 mM, 100 uL, Assay Buffer 50 mL, GST enzyme 50U/mL, 200 uL, GST enzyme 50U/mL, 200 uL, storage: -20 deg C


Catalog Number: (102996-718)
Supplier: Anaspec Inc
Description: Beta-Amyloid Peptide (1-40), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4233.8, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV, Appearance: Lyophilized off-white powder, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (103010-244)
Supplier: Anaspec Inc
Description: SensoLyte* 520 MMP-12 Assay Kit *Fluorimetric*, Components: MMP-12 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability


Catalog Number: (103010-690)
Supplier: Anaspec Inc
Description: Recombinant Protein A-Biotin, Purity: >95% by SDS-PAGE, Protein A is a non-glycosylated cell-wall protein of Staphylococcus aureus that can bind Fc part of immunoglobulin molecule of different species with strong affinity, Storage: 4 deg C, size: 5 mg


Catalog Number: (103009-620)
Supplier: Anaspec Inc
Description: [Lys(Ac)5/8/12/16]-Histone H4 (1-25)-GSGSK, Purity: HPLC >/= 95%, MW: 2373.7, Sequence: [SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGSK] amino acid residues 1-25. It is acetylated at lysine 5/8/12/16. Store: -20 deg C, Size: 1mg


Catalog Number: (102996-660)
Supplier: Anaspec Inc
Description: Beta-Amyloid Peptide (1-40), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4233.8, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16 of 2,094
no targeter for Bottom