You Searched For: Hytest Ltd

Description: 43Gap 26, Connexin Mimetic, Sequence: VCYDKSFPISHVR, Purity: By HPLC greater than or equal to 95%, Gap 26 peptide is derived from the first extracellular loop sequence of connexin (Cx) 43, Molecular Weight: 1550.8, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-452

Supplier: Anaspec Inc

Sale

Description: FDG, Synonym: Fluorescein di - B - D - galactopyranoside, most sensitive fluorogenic substrates for detecting B-galactosidase, Minimum Purity: 95%, MW: 656.59, Spectral Properties: Abs/Em = 492/520 nm, Solvent System: DMSO, Appearance: Off-white solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103011-308

Supplier: Anaspec Inc

Sale

Description: GALA, Pore - Forming Peptide, Sequence: WEAALAEALAEALAEHLAEALAEALEALAA, Purity: By HPLC greater than or equal to 95%, synthetic peptide with a glutamic acid-alanine-leucine-alanine (EALA) repeat, Molecular Weight: 3032.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-280

Supplier: Anaspec Inc

Sale

Description: OVA (241-270), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3421.9, Sequence: SMLVLLPDEVSGLEQLESIINFEKLTEWTS, peptide residues 241 to 270, a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-218

Supplier: Anaspec Inc

Sale

Description: Histatin - 5, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): DSHAKRHHGYKRKFHEKHHSHRGY, Molecular Weight: 3036.3, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-240

Supplier: Anaspec Inc

Sale

Description: 5 - TAMRA, Special Formulation, purified single isomer, Synonym: 5-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/568 nm, Solvent System: DMF/DMSO, Appearance: Dark red solid, Storage -20 deg C, Size: 100 mg

Catalog Number: 103010-836

Supplier: Anaspec Inc

Sale

Description: Streptavidin, nonglycosylated, tetrameric protein, 55,000-dalton, with each subunit able to bind a single molecule of the vitamin biotin, purified from Streptomyces avidinii, Physical State: Lyophilized powder, Solvent System: water, Storage -20 deg C desiccated, Size: 5mg

Catalog Number: 103005-956

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-1, PAR-1 Agonist, amide, Sequence: TFLLRNPNDK-NH2, Purity: By HPLC greater than or equal to 95%, peptide is a thrombin receptor activating peptide, Molecular Weight: 1216.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-556

Supplier: Anaspec Inc

Sale

Description: NDA, Synonym: Naphthalene - 2,3 - dicarboxaldehyde, Fluorogenic indicator for primary amino group; Widely used for quantitation of peptides and proteins, MW: 184.2, Spectral Properties: Abs/Em = 419/493 nm, Solvent System: DMSO or DMF, MF: C12H8O2, CAS no: 70848-82-7, Size: 100mg

Catalog Number: 103011-112

Supplier: Anaspec Inc

Sale

Description: TNO211, Purity: HPLC >/= 95%, Molecular Weight: 1326.5, Sequence: DABCYL-(Y-Abu)-Pro-Gln-Gly-Leu-Glu(EDANS)-Ala-Lys-NH2, A highly soluble fluorogenic MMP substrate for MMP-2, 8, 12, 13, 14, also can detect MMP activity in culture medium from endothelial cells, Size: 1 mg

Catalog Number: 102996-712

Supplier: Anaspec Inc

Sale

Description: MeOSuc-Ala-Ala-Pro-Val-AFC, Purity: HPLC >/= 95%, Molecular Weight: 681.7, Sequence: MeOSuc-AAPV-AFC, Appearance: Powder, A highly specific neutrophil elastase substrate, Abs/Em=380/500 nm, Storage: -20 deg C, Size: 10 mg

Catalog Number: 102996-448

Supplier: Anaspec Inc

Sale

Description: Cys(Npys)-TAT (47-57), FAM-labeled, cell penetrating and carrier peptide applicable in conjugation studies, Purity: HPLC >/= 95%, Sequence (One-Letter Code): C(Npys)YGRKKRRQRRR-K(FAM)-NH2, MW: 2302.7, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-424

Supplier: Anaspec Inc

Sale

Description: Protegrine-1 (PG-1), amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2155.7, Sequence: RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge: 6-15 and 8-13), Protegrin-1 (PG-1) with a modified C-terminal amide, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-472

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)4]-Histone H3 (1-10), H3K4(Me1), Sequence: ART-K(Me1)-QTARKS, Purity: By HPLC greater than or equal to 95%, peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-4, Molecular Weight: 1160.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-016

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)9]-Histone H3 (1-21), H3K9(Me1), Purity: HPLC >/= 95%, MW: 2269.1, Sequence: [ARTKQTAR-K(Me1)-STGGKAPRKQLA], monomethylated lysine at position 9 of the 1-21 amino acid histone H3 peptide. Store: -20 deg C, Size: 1mg

Catalog Number: 103009-504

Supplier: Anaspec Inc

Sale

Description: 5 - FITC Fluorescein isothiocyanate, Molecular Weight 389.38, Molecular Formula C21H11NO5S, Spectral Properties Abs/Em = 494/519 nm, Solvent System DMSO, Physical State Solid, Slightly water soluble, Storage -20 deg C, Size: 1g

Catalog Number: 102998-068

Supplier: Anaspec Inc

Sale