Sort Results

List View Easy View (new)
SearchResultCount:"2094"
Description: Human Beta-Amyloid (2-40)
Catalog Number: 102997-266
Supplier: Anaspec Inc


Description: 5-TAMRA cadaverine, Synonym: Tetramethylrhodamine-5-carboxamide cadaverine, purified single isomer of 5(6)-TAMRA cadaverine mixture, for biological application, MW: 514.62, Spectral Properties: Abs/Em = 545/576 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 5 mg
Catalog Number: 103011-030
Supplier: Anaspec Inc


Description: Scrambled - beta - Amyloid (1 - 40), human, Sequence: AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, Apperance: Lyophilized white powder, freely soluble in basic buffer, Size: 0.5 mg
Catalog Number: 102999-804
Supplier: Anaspec Inc


Description: Vasoactive Intestinal Peptide, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3684.2, Sequence: FAM-HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, label: FAM, This is a fluorescent (FAM)-labeled VIP, Abs/Em=492/518 nm, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-398
Supplier: Anaspec Inc


Description: Protein A-HiLyte* Fluor 750 Conjugate, Purity: >95% SDS-PAGE, Fluorescence: Near-infrared Fluorescence, Excitation/Emission wavelength= 754 nm/ 778 nm, Applications: to detect primary antibodies in Western Immunoblot from many species, size: 1 mg
Catalog Number: 103010-700
Supplier: Anaspec Inc


Description: MOG (35-55), human, Sequence: MEVGWYRPPFSRVVHLYRNGK, Purity: >/= 95%, This is amino acids 92 to 106 fragment of the myelin oligodendrocyte glycoprotein, can be used to induce experimental autoimmune encephalomyelitis, Molecular Weight: 2592, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-806
Supplier: Anaspec Inc


Description: Beta - Amyloid (1 - 43), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4615.2, Solid AB (1-43) fibril is the most fibrillogenic of all the AB peptides, Apperance: Powder, Size: 1 mg
Catalog Number: 102999-854
Supplier: Anaspec Inc


Description: [Gly22] - beta - Amyloid (1 - 42), E22G Arctic Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4442.1, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-114
Supplier: Anaspec Inc


Description: SensoLyte* FDP Protein Phosphatase Assay Kit *Fluorimetric*, Components: FDP 1 vial, Assay buffer, pH 6.5 60 ml, 10X Lysis buffer 50 ml, Triton X-100 500 uL, Stop solution 30 ml, 1 M DTT 100 ul, DMSO 500 ul, storage: -20 deg C
Catalog Number: 103010-108
Supplier: Anaspec Inc


Description: 5(6)-TAMRA cadaverine, Synonym: Tetramethylrhodamine 5-(and-6)-carboxamide cadaverine, reagent for modifying carboxy groups via EDC-mediated reactions, Molecular Weight: 514.62, Spectral Properties: Abs/Em = 544/570 nm, Solvent System DMF or DMSO, Size: 10 mg
Catalog Number: 103011-028
Supplier: Anaspec Inc


Description: Caloxin 1b1, for binding to extracellular domain 1 of PMCA4, to examine its effects on smooth muscle and endothelium, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): TAWSEVLHLLSRGGG, Molecular Weight: 1582.8, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-690
Supplier: Anaspec Inc


Description: SensoLyte* Rh110 Enterokinase Activity Assay Kit *Fluorimetric*, Components: Rh110 Enterokinase substrate 2 mM, 50 uL, Rh110 2 mM, 10 uL, Recombinant bovine enterokinase 40 uL, 2X Assay Buffer 25 mL, Enterokinase Inhibitor 50 mM, 20 uL
Catalog Number: 103010-628
Supplier: Anaspec Inc


Description: Dihydroethidium, Synonym: Hydroethidine, 5 mM solution in DMSO, Bind to DNA/RNA (red fluorescence) upon oxidation, Molecular Weight: 315.4, Spectral Properties Abs/Em = 518/605 nm (after oxidation), CAS number: 104821-25-2, Molecular Formula: C21H21N3, Storage: -20C, Size: 1 ml
Catalog Number: 103011-346
Supplier: Anaspec Inc


Description: Histone H4 (8-25)-WC, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2278.7, Sequence: KGLGKGGAKRHRKVLRDNWC-NH2, amidated version of Histone H4 residues 8-25. It contains two additional residues (WC) on its C-terminus, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-684
Supplier: Anaspec Inc


Description: CEF8, Influenza Virus NP (383 - 391), SRYWAIRTR, HLA-B*3501 restricted influenza virus nucleoprotein epitope, Sequence (Three-Letter Code) H - Ser - Arg - Tyr - Trp - Ala - Ile - Arg - Thr - Arg - OH, MW: 1208.4, Physical State: Solid, at-20deg C, Size: 1mg
Catalog Number: 102997-152
Supplier: Anaspec Inc


Description: DYKDDDDK, Purity: HPLC >/- 95%, Molecular Weight: 1013, Appearance: Powder, This epitope tag is a short hydrophilic, highly charged peptide. It is the most widely used epitope tag employed in structural and functional studies of proteins, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103003-362
Supplier: Anaspec Inc


1 - 16 of 2,094