You Searched For: Hytest Ltd

Description: Renin Substrate, human, Purity: HPLC >/= 95%, Molecular Weight: 1760, Sequence: H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn-OH, Appearance: Powder, it acts on this sequence serving as its substrate yielding Angiotensin I and VIHN, Storage: -20 deg C, Size: 1mg

Catalog Number: 102996-064

Supplier: Anaspec Inc

Sale

Description: TRP-2, Tyrosinase-related Protein 2 (181-188), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1088.3, Sequence: VYDFFVWL, derived from tyrosinase-related protein 2 (TRP2) residues 181-188, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-464

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Mouse Renin Assay Kit *Fluorimetric*, Components: Mouse renin substrate 50 ul, 5-FAM 100 u
M, 10 ul, Mouse Prorenin 0.5 mg/mL, 20 ul, Assay buffer 25 mL, Trypsin Activation buffer 300 ul, Trypsin Inhibitor 10 mM, 20 ul, Renin Inhibitor 1 mM,10 ul

Catalog Number: 103010-526

Supplier: Anaspec Inc

Sale

Description: Peptide YY (3-36), human, Purity: HPLC >/= to 95%, Molecular Weight: 4049.5, Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a Y2R agonist, is released from the gastrointestinal tract postprandially, Size: 0.5 mg

Catalog Number: 102996-562

Supplier: Anaspec Inc

Sale

Description: OVA (257-264) [SIINFEKL], Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 963.2, Sequence: (One-Letter Code) SIINFEKL, class I (Kb)-restricted peptide epitope of OVA, an octameric peptide, Appearance: white powder, Storage: At -20 degree C, Size: 1mg

Catalog Number: 103002-842

Supplier: Anaspec Inc

Sale

Description: [pSer28]-Histone H3 (21-44)-GK, Purity: HPLC >/= 95%, MW: 2997.5, Sequence: [ATKAARK-pS-APATGGVKKPHRYRPGG-K(Biotin)] phosphorylated at Ser28 with an additional C-terminal glycine followed by a biotinylated lysine. Biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-488

Supplier: Anaspec Inc

Sale

Description: TAT (47 - 57), Purity: By HPLC >/= 95%, MW: 1559.9, Sequence: (One-Letter Code): YGRKKRRQRRR, Sequence(Three-Letter Code): H - Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - OH, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-824

Supplier: Anaspec Inc

Sale

Description: Biotin - ACTH (1 - 39), human, Sequence: Biotin - SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4768.4, Apperance: Powder, application: used in ELISA assays, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102999-762

Supplier: Anaspec Inc

Sale

Description: Gila Exendin 4

Catalog Number: 103003-724

Supplier: Anaspec Inc

Sale

Description: Sulforhodamine 101 cadaverine

Catalog Number: 103011-036

Supplier: Anaspec Inc

Sale

Description: M13 Skeletal Muscle Myosin Light Chain Kinase Peptide, SK - MLCK M13, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2964.5, Sequence: (One-Letter Code) KRRWKKNFIAVSAANRFKKISSSGAL, Storage: At -20 degree C, Size: 1mg

Catalog Number: 103002-830

Supplier: Anaspec Inc

Sale

Description: BNP - 45 peptide, mouse, Purity: >/= 95% HPLC, Molecular Weight: 4919.6, Sequence: SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL, essential for NP bioactivity, although sequence identity when studied with other BNP hormones, Storage: -20 deg C, size: 0.5MG

Catalog Number: 102971-866

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 594 acid, spectral characteristics as Texas Red, high extinction coefficient, low correction factor, MW: 751.87, Spectral Property: Abs/Em = 593/616 nm, Solvent System: DMF or DMSO, Form: Solid, Storage -20 deg C Store away from oxidizing agent, Size: 10mg

Catalog Number: 103010-954

Supplier: Anaspec Inc

Sale

Description: Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled, Sequence: Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23), Purity: HPLC greater than or equal to 95%, Molecular Weight: 3308.8, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102999-764

Supplier: Anaspec Inc

Sale

Description: Bovine B-Casein, monophosphopeptide, for characterization of phosphorylated peptides in liquid chromatography, Purity: HPLC >/=95%, Sequence (1-Letter Code): FQ-pS-EEQQQTEDELQDK, MW: 2062, Form: Lyophilized white powder, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-364

Supplier: Anaspec Inc

Sale

Description: Poly-Y-D-Glutamic Acid Construct, Sequence: Ac-(Y-e)15-C-NH2, Purity: By HPLC greater than or equal to 95%, capsule inhibits innate host defense through its antiphagocytic action, Molecular Weight: 2099, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-710

Supplier: Anaspec Inc

Sale