Print…

You Searched For: Hytest Ltd


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-103006-980

Erktide 1 mg

Description: Erktide, peptide substrate for ERK2 (extracellular regulated protein kinase 2) whose activity is regulated by mitogenic stimuli, Purity: HPLC >/= 95%, Sequence (One-Letter Code): IPTTPITTTYFFFK, MW: 1677, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-980
Supplier: Anaspec Inc
Image Unavailable-103003-136

5-FAM-KRREILSRRPSYR 1 mg

Description: 5-FAM-KRREILSRRPSYR, Purity: HPLC >/- 95%, Molecular Weight: 2075.3, Appearance: Lyophilized yellow powder, Storage: -20 deg C, size: 1 mg
Catalog Number: 103003-136
Supplier: Anaspec Inc
Image Unavailable-102996-082

Bombesin peptide 1 mg

Description: Bombesin peptide, Purity: HPLC >/= to 95%, Molecular Weight: 1620.9, Sequence: Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-082
Supplier: Anaspec Inc
Image Unavailable-103008-004

[Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin) H3K27(Me2) 0.25 mg

Description: [Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me2), biotin-labeled, Sequence: ATKAAR-K(Me2)-SAPATGGVKKPHRYRPG-GK(Biotin), Purity: By HPLC >/= 95%, residues 21 to 44 di-methylated at Lys-27, Molecular Weight: 2945.5, Size: 0.25 mg
Catalog Number: 103008-004
Supplier: Anaspec Inc
Image Unavailable-103006-484

Transportan 1 mg

Description: Transportan a 27 amino acids (aa) long chimeric peptide containing 12 aa from the amino-terminal part of the neuropeptide galanin, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GWTLNSAGYLLGKINLKALAALAKKIL, MW: 2841.5, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-484
Supplier: Anaspec Inc
Image Unavailable-103005-328

RGD - 4C 5 mg

Description: RGD - 4C, Purity: >/= 95%, MW: 1145.3, Sequence: ACDCRGDCFCG (Disulfide bridge: 2-10 and 4-8)a double cyclic peptide, binds preferentially to integrins at sites of tumor angiogenesis, Appearance: Lyophilized white powder, freely soluble in H2O, Size: 5 mg
Catalog Number: 103005-328
Supplier: Anaspec Inc
Image Unavailable-103002-738

SAMS Peptide 5mg

Description: SAMS Peptide, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1778.2, Sequence: (one-Letter Code) HMRSAMSGLHLVKRR - NH2, synthetic peptide substrate specific for AMP-activated protein kinase (AMPK), Storage: At -20 Degree C, Size: 5mg
Catalog Number: 103002-738
Supplier: Anaspec Inc
Image Unavailable-103003-186

HEL (46-61) 1 mg

Description: HEL (46-61), Purity: HPLC >/- 95%, Molecular Weight: 1753.9, Sequence: H-Asn-Thr-Asp-Gly-Ser-Thr-Asp-Tyr-Gly-Ile-Leu-Gln-Ile-Asn-Ser-Arg-OH, This peptide is amino acids 46 to 61 fragment of the hen egg lysozyme, also used in in MHC related studies, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-186
Supplier: Anaspec Inc
Image Unavailable-103007-120

Beta - Amyloid (25 - 35) 1 mg

Description: Beta - Amyloid (25 - 35), scrambled, Human, mouse/rat, Sequence: MAKGINGISGL, Purity: By HPLC greater than or equal to 95%, used to recognize its structure and functions, Molecular Weight: 1060.3, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-120
Supplier: Anaspec Inc
Image Unavailable-103006-990

Beta-Amyloid (1-15) Human 1 mg

Description: Beta-Amyloid (1-15), Human, Purity: HPLC >/= 95%, Sequence (1-Letter Code): DAEFRHDSGYEVHHQ, Sequence (3-Letter Code): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH, Molecular weight: 1826.9, Physical State: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103006-990
Supplier: Anaspec Inc
Image Unavailable-102996-472

Thrombin Receptor Activator 5 mg

Description: Thrombin Receptor Activator for Peptide 6 (TRAP-6), Purity: HPLC >/= to 95%, Molecular Weight: 748.9, Sequence: H-Ser-Phe-Leu-Leu-Arg-Asn-OH, This peptide forms the N-terminal sequence left after thrombin cleavage, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102996-472
Supplier: Anaspec Inc
Image Unavailable-103011-118

Congo Red 1 g

Description: Congo Red, UltraPure Grade, Early diagnosis and classification of amyloid deposition, Molecular Weight: 696.7, Spectral Properties: Abs/Em = 497/NA nm, Solvent System: Water, CAS number: 573-58-0, Molecular formula: C32H22N6Na2O6S2, Physical State: Solid, Storage: -20 deg C, Size: 1 g
Catalog Number: 103011-118
Supplier: Anaspec Inc
Image Unavailable-103004-434

EGF Receptor Substrate 2 [DADE - pY - LIPQQG] 1 mg

Description: EGF Receptor Substrate 2 [DADE - pY - LIPQQG], Biotinylated, derived from an autophosphorylation site (Tyr992) of EGFR, Purity: Peak Area By HPLC >/= 95%, MW: 1556.6, Sequence (One-Letter Code): Biotin-DADE-pY-LIPQQG, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103004-434
Supplier: Anaspec Inc
Image Unavailable-103007-624

Myristolated PKC Zeta Pseudosubstrate (ZIP) 1 mg

Description: Myristolated PKC Zeta, Pseudosubstrate (ZIP), Sequence: Myr-SIYRRGARRWRKL, Purity: By HPLC >/= 95%, interacts with PKC family isoforms and disrupt conventional PKC targeting and translocation, Molecular Weight: 1928.5, Size: 1 mg
Catalog Number: 103007-624
Supplier: Anaspec Inc
Image Unavailable-103008-964

SensoLyte* 390 ACE2 Activity Assay Kit 100 Assay

Description: SensoLyte* 390 ACE2 Activity Assay Kit, Fluorimetric, Contains: Mca/Dnp, ACE2 substrate 5mM, Mca fluorescence reference standard 1mM, Assay Buffer 20mL, Inhibitor of ACE2 100uM, Stop Solution 10mL, Storage: -20 deg C, Size: 100 Assay(96-well plate)
Catalog Number: 103008-964
Supplier: Anaspec Inc
Image Unavailable-102996-490

Beta-Amyloid (1-38) 0.5 mg

Description: Beta-Amyloid (1-38), Human, Purity: HPLC >/= 95%, Molecular Weight: 4131.6, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-490
Supplier: Anaspec Inc
545 - 560 of 2,094