You Searched For: Hytest Ltd

Description: Scrambled Jag1 peptide is scrambled sequence of JAG-1 (188-204), Jagged-1 (188-204), Notch Ligand, DSL Peptide, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): SC-Jag1, Molecular Weight: 2107.4, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-692

Supplier: Anaspec Inc

Sale

Description: RYR2 (2460-2495), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4103.9, Sequence: GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP, amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2), controls calcium release, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-442

Supplier: Anaspec Inc

Sale

Description: Resorufin B - D - Galactopyranoside, for sensitive enzyme measurements in ELISA, by flow cytometry and to detect immobilized B-galactosidase activity, Molecular Weight: 375.33, Spectral Properties: Abs/Em = 573/585 nm, Solvent System: DMSO, Size: 25 mg

Catalog Number: 103011-314

Supplier: Anaspec Inc

Sale

Description: Histone H2B (21-41), biotin-labeled, Sequence: AQKKDGKKRKRSRKESYSIYVGG-K(Biotin), Purity: By HPLC >/= 95%, Histone 2B amino acid residues 21 to 41 with a C-terminal GG linker followed by a biotinylated lysine, Molecular Weight: 3024.6, Storage: -20 C, Size: 1 mg

Catalog Number: 103008-048

Supplier: Anaspec Inc

Sale

Description: 5 - FITC Microscale Protein Labeling Kit AnaTag™ 'Ultra Convenient'

Catalog Number: 103010-376

Supplier: Anaspec Inc

Sale

Description: SensoLyte* ADHP Peroxidase Assay Kit, Components: ADHP 10 mM, 250 ul, H2O2 1 vial, Assay buffer 60 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-128

Supplier: Anaspec Inc

Sale

Description: Tetramethylrhodamine - 5 - maleimide, frequently used reagents for thiol modifications of peptides and proteins, MW: 481.51, Spectral Properties: Abs/Em = 540/567 nm, Solvent System: DMF or DMSO, Form: Dark violet solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103011-012

Supplier: Anaspec Inc

Sale

Description: Antennapedia Peptide, FAM-labeled, Sequence: 5-FAM-RQIKIWFQNRRMKWKK-NH2, Purity: By HPLC >/= 95%, This peptide is also called penetratin and this product is FAM-labeled with Abs/Em = 492/518 nm, Molecular Weight: 2604.1, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-972

Supplier: Anaspec Inc

Sale

Description: BNP-32, human, Purity: HPLC >/= to 95%, Molecular Weight: 3464.1, Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, Appearance: Lyophilized white powder, It is also called the brain natriuretic peptide because it was first identified in porcine brain, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-424

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti - MOG(35 - 55) IgG Quantitative ELISA Kit (mouse/rat), Contains: Pre-coated and pre-blocked 96-well strip plate, Standard for calibration, A detailed protocol, Storage: 4degree C, Size: 96 assays

Catalog Number: 102997-814

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Rh110 Matriptase Activity Assay Kit, Fluorimetric, Contains: Rh110 Matriptase substrate, Rh110 fluorescence reference standard, Matriptase, human recombinant, Assay Buffer, Leupeptin, Storage: -20 degree C, Size: 100 Assays (96-well plate)

Catalog Number: 103008-976

Supplier: Anaspec Inc

Sale

Description: Pyrrhocoricin, Sequence: VDKGSYLPRPTPPRPIYNRN, Purity: By HPLC greater than or equal to 95%, proline-rich cationic antibacterial peptide pyrrhocoricin kills responsive bacteria, Molecular Weight: 2340.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-416

Supplier: Anaspec Inc

Sale

Description: Big Endothelin-1 (1-38), human, Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11), Purity: By HPLC >/= 95%, Big Endothelin-1 (1-38) is precursor of endothelin 1, Molecular Weight: 4283, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-562

Supplier: Anaspec Inc

Sale

Description: MUC5AC 3 glycopeptide is a 16-amino acid modified fragment of mucin 5/MUC5AC, where T* is a GalNac labeled threonine 3, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): GT-T*-PSPVPTTSTTSAP, Molecular Weight: 1703.9, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-584

Supplier: Anaspec Inc

Sale

Description: Fibrinopeptide B, human, Purity: HPLC >/- 95%, MW: 1553.6, Sequence: Pyr-Gly-Val-Asn-Asp-Asn-Glu-Glu-Gly-Phe-Phe-Ser-Ala-Arg-OH, Appearance: Powder, is an N-terminal modified peptide with pyroglutamylation, Size: 1 mg

Catalog Number: 103003-348

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 440 West Nile Virus Protease Assay Kit*Fluorimetric*, Components: Pyr-RTKR-AMC, WNV protease substrate 5mM DMSO, AMC 5 mM DMSO solution, 10 uL, Assay Buffer 2 x 50 mL, WNV Protease Inhibitor undeca-D-ArgNH2 1 mM DMSO solution, 10 uL

Catalog Number: 103010-398

Supplier: Anaspec Inc

Sale