Print…

You Searched For: Hytest Ltd


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-103011-376

Prodan 25 mg

Description: Prodan, Synonym: 6 - Propionyl - 2 - dimethylaminonaphthalene, Environment-sensitive dye for studying membranes and structures of proteins, MW: 227.3, Spectral Properties: Abs/Em = 363/497 nm, Solvent System: DMF, Molecular Formula: C15H17NO, CAS No: 70504-01-7, Size: 25 mg
Catalog Number: 103011-376
Supplier: Anaspec Inc
Image Unavailable-103011-196

Pluronic* F-127 100 mL

Description: Pluronic* F-127, 10% solution in water, Cell culture reagent for dissolving AM esters, Solution: solution, Storage: 4 degree C protected from light, Store away from oxidizing agent, Size: 100 mL
Catalog Number: 103011-196
Supplier: Anaspec Inc
Image Unavailable-103011-146

BrdU 25 mg

Description: BrdU, Synonym: 5 - Bromo - 2’ - deoxyuridine, Biomarker for cell cycle and cell proliferation, MW: 307.1, Spectral Properties: Abs/Em = ND/none nm, Solvent System: DMSO, Form: Solid, MF: C9H11BrN2O5, CAS No: 59-14-3, Storage -20 deg C desiccated and protected from light, Size: 25 mg
Catalog Number: 103011-146
Supplier: Anaspec Inc
Image Unavailable-102996-450

Z-Gly-Gly-Arg-AFC 10 mg

Description: Z-Gly-Gly-Arg-AFC, Purity: HPLC >/= 95%, Molecular Weight: 633.5, Sequence: Z-GGR-AFC, Appearance: Powder, This is a fluorescent plasminogen activator acrosine substrate, Abs/Em=380/500, Storage: -20 deg C, Size: 10 mg
Catalog Number: 102996-450
Supplier: Anaspec Inc
Image Unavailable-103005-964

Angiotensin I Converting Enzyme 2, ACE - 2/Caspase - 1 Substrate 1 mg

Description: Angiotensin I Converting Enzyme 2, ACE - 2/Caspase - 1 Substrate, Purity: By HPLC >/= 95%, MW: 1145.2, Sequence: (One-Letter Code): Mca-YVADAPK(Dnp), Physical State: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103005-964
Supplier: Anaspec Inc
Image Unavailable-103007-638

[Cys26]-beta-Amyloid (1-42) S26C beta-Amyloid (1-42) 0.5 mg

Description: [Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4530.2, Apperance: Lyophilized white powder, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-638
Supplier: Anaspec Inc
Image Unavailable-103008-100

Mant-GTP 500ul

Description: Mant-GTP, 2'-/3'-O-(N'-Methylanthraniloyl)guanosine-5'-O-triphosphate, trisodium salt, Formula: C18H20N6Na3O15P3, Molecular weight: 722.28Spectral Property: Abs/Em - 355/448 nm, fluorescent analog of ATP, detecting nucleotide-protein interaction, Storage: -20 degree C, Size: 500ul
Catalog Number: 103008-100
Supplier: Anaspec Inc
Image Unavailable-103007-832

Noxa A BH3 peptide cell permeable 1 mg

Description: Noxa A BH3 peptide, cell permeable, Sequence: rrrrrrrrGAELPPEFAAQLRKIGDKVYC, Purity: By HPLC greater than or equal to 95%, This cell permeable peptide is derived from the BH3 domain, Molecular Weight: 3555.2, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-832
Supplier: Anaspec Inc
Image Unavailable-102999-364

[Lys0] - Bradykinin (Kallidin) 5 mg

Description: [Lys0] - Bradykinin (Kallidin), sequence: KRPPGFSPFR, Molecular Weight: 1188.4, potent inflammatory mediators produced during acute and chronic inflammation, biological actions are mediated by two distinct receptors, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102999-364
Supplier: Anaspec Inc
Image Unavailable-103011-046

DABCYL acid 1 g

Description: DABCYL acid, Synonym: 4-((4-(dimethylamino)phenyl)azo)benzoic acid, UltraPure Grade, acceptors for developing FRET-based nucleic acid probes and protease substrates, Molecular Weight: 269.3, Spectral Properties: Abs/Em = 425/none nm, Solvent System: DMF or DMSO, Size: 1g
Catalog Number: 103011-046
Supplier: Anaspec Inc
Image Unavailable-103007-640

[Cys26]-beta-Amyloid (1-42) S26C beta-Amyloid (1-42) 1 mg

Description: [Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4530.2, Apperance: Lyophilized white powder, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-640
Supplier: Anaspec Inc
Image Unavailable-103011-050

DABCYL C2 maleimide 25 mg

Description: DABCYL C2 maleimide, excellent thiol-reactive building block for developing DABCYL-based FRET probes, Purity: 95%, MW: 391.42, Spectral Properties: Abs/Em = 428/none nm, Solvent System: DMF or DMSO, Physical State: Solid, MF: C21H21N5O3, Storage -20 deg C, Size: 25 mg
Catalog Number: 103011-050
Supplier: Anaspec Inc
Image Unavailable-103009-944

PAMP (1-20)

Description: Proadrenomedullin N-terminal 20 peptide, PAMP (1-20), Purity: HPLC >/= 95%, MW: 2460.9, Sequence: [ARLDVASEFRKKWNKWALSR-NH2] biologically active molecule produced by posttranslational processing of proadrenomedullin. Appearance: Off white solid, Store: -20 deg C, Size: 5mg
Catalog Number: 103009-944
Supplier: Anaspec Inc
Image Unavailable-103007-462

NY-ESO-1 (87-111) 1 mg

Description: NY-ESO-1 (87-111), Sequence: LLEFYLAMPFATPMEAELARRSLAQ, Purity: By HPLC greater than or equal to 95%,This is amino acids 81 to 111 fragment of the NY-ESO-1, expressed by many tumors of different histological types, Molecular Weight: 2869.4, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-462
Supplier: Anaspec Inc
Image Unavailable-103011-084

B-PE (B-Phycoerythrin) 1 mg

Description: B-PE (B-Phycoerythrin), fluorescent protein from phycobiliprotein family, isolated from cyanobacteria, MW: Approx 240,000, Spectral Property: Abs/Em = 545/575 nm, Solvent System: Water, Physical State Liquid, Storage: 4 deg C, Application: flow cytometry, Size: 1 mg
Catalog Number: 103011-084
Supplier: Anaspec Inc
Image Unavailable-103010-532

SensoLyte® 520 Cathepsin B Assay Kit *Fluorimetric*

Description: SensoLyte® 520 Cathepsin B Assay Kit *Fluorimetric*
Catalog Number: 103010-532
Supplier: Anaspec Inc
497 - 512 of 2,094