You Searched For: Hytest Ltd

Description: DABCYL Plus* acid, acceptors for developing FRET-based nucleic acid probes and protease substrates, high hydrophobicity, poor water solubility, Purity: 95%, MW: 377.42, Spectral: Abs/Em = 437/none nm, Solvent System: Water or DMSO, Storage: -20 deg C, Size: 100 mg

Catalog Number: 103011-052

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid Peptide (1-42), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4418, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized off-white powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-720

Supplier: Anaspec Inc

Sale

Description: 5-FAM, SE, Synonym: 5-Carboxyfluorescein, succinimidyl ester; 5-FAM, NHS ester, Molecular Weight 473.39, Molecular Formula: C25H15NO9, Appearance: Orange solid, Purity: >90% (TLC), >90% (HPLC), Spectral Properties: Abs/Em = 492/518 nm, Solvent System: DMF or DMSO, Size: 100 mg

Catalog Number: 103010-776

Supplier: Anaspec Inc

Sale

Description: HIV Protease FRET Substrate I, Purity: HPLC >/= 95%, Molecular Weight: 1532.5, Sequence: DABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS, Appearance: Lyophilized red powder, It is widely used for the continuous assay for HIV protease activity, Size: 1 mg

Catalog Number: 102996-366

Supplier: Anaspec Inc

Sale

Description: Glucagon (1-29), bovine, human, porcine, Purity: HPLC >/- 95%, Molecular Weight: 3482.8, Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT, this peptide secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels, Size: 1 mg

Catalog Number: 103003-410

Supplier: Anaspec Inc

Sale

Description: Integrin - Binding Site, Sequence: GRGDNP, Purity: By HPLC greater than or equal to 95%, RGD-containing sequence is integrin-binding site, RGD peptides are found in both extracellular matrix (ECM), Molecular Weight: 614.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-154

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 4742.4, Sequence: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: TAMRA, Appearance: Lyophilized red powder, this is a fluorescent labeled B-Amyloid peptide, Abs/Em=551/567 nm, Size: 0.1 mg

Catalog Number: 103003-174

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 HIV Protease Assay Kit *Fluorimetric*, Components: HIV-1 protease substrate 600 ul, EDANS 100 u
M DMSO solution, 20 ul, Pepstatin A 27.4 u
g powder, 2X Assay buffer 50 mL, Stop solution 30mL, DMSO 100 ul, DMSO 100 ul, storage: -20 deg C

Catalog Number: 103010-148

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti-Mouse/Rat beta-Amyloid (1-40) Quantitative ELISA Kit, Colorimetric, detect peptide in brain lysate, cerebrospinal fluid/plasma, Wells are pre-coated and blocked with proprietary solution, Storage: 2-8 degree C, Size: One 96-well strip plate

Catalog Number: 103001-638

Supplier: Anaspec Inc

Sale

Description: Prodan, Synonym: 6 - Propionyl - 2 - dimethylaminonaphthalene, Environment-sensitive dye for studying membranes and structures of proteins, MW: 227.3, Spectral Properties: Abs/Em = 363/497 nm, Solvent System: DMF, Molecular Formula: C15H17NO, CAS No: 70504-01-7, Size: 25 mg

Catalog Number: 103011-376

Supplier: Anaspec Inc

Sale

Description: Pluronic* F-127, 10% solution in water, Cell culture reagent for dissolving AM esters, Solution: solution, Storage: 4 degree C protected from light, Store away from oxidizing agent, Size: 100 mL

Catalog Number: 103011-196

Supplier: Anaspec Inc

Sale

Description: Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3616.4, Sequence: KSKKAVWHKLLSKQRRRAVVACFRMTPLYN, amino acids 3614-3643 fragment, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-282

Supplier: Anaspec Inc

Sale

Description: BrdU, Synonym: 5 - Bromo - 2’ - deoxyuridine, Biomarker for cell cycle and cell proliferation, MW: 307.1, Spectral Properties: Abs/Em = ND/none nm, Solvent System: DMSO, Form: Solid, MF: C9H11BrN2O5, CAS No: 59-14-3, Storage -20 deg C desiccated and protected from light, Size: 25 mg

Catalog Number: 103011-146

Supplier: Anaspec Inc

Sale

Description: Z-Gly-Gly-Arg-AFC, Purity: HPLC >/= 95%, Molecular Weight: 633.5, Sequence: Z-GGR-AFC, Appearance: Powder, This is a fluorescent plasminogen activator acrosine substrate, Abs/Em=380/500, Storage: -20 deg C, Size: 10 mg

Catalog Number: 102996-450

Supplier: Anaspec Inc

Sale

Description: Angiotensin I Converting Enzyme 2, ACE - 2/Caspase - 1 Substrate, Purity: By HPLC >/= 95%, MW: 1145.2, Sequence: (One-Letter Code): Mca-YVADAPK(Dnp), Physical State: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-964

Supplier: Anaspec Inc

Sale

Description: [Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4530.2, Apperance: Lyophilized white powder, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-638

Supplier: Anaspec Inc

Sale