You Searched For: Hytest Ltd


2,094  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"2094"
Description: SensoLyte* 520 MMP Profiling Kit *Fluorimetric*, Components: Microplate pre-coated with 16 different MMP substrates 2 identical 96-well plates, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 100 ul, Assay buffer 40 mL, Stop solution 20 mL, storage: -20 deg C
Catalog Number: 103010-164
Supplier: Anaspec Inc


Description: [Lys(Me3)4]-Histone H3 (1-21), H3K4(Me3), Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA, Purity: By HPLC >/= 95%, peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-4, Molecular Weight: 1188.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-966
Supplier: Anaspec Inc


Description: Biotin - beta - Amyloid (1 - 40), Human, label: FAM, Purity: HPLC >/- 95%, Molecular Weight: 4556.2, Appearance: Lyophilized white powder, Sequence: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, FAM is preferred over FITC, Storage -20 deg C, size: 0.1 mg
Catalog Number: 103003-542
Supplier: Anaspec Inc


Description: DEAC, acid, Synonym: 7-Diethylaminocoumarin-3-carboxylic acid, useful blue fluorescent building block for labeling amine-containing biomolecules, Molecular Weight: 261.27, Spectral Properties: Abs/Em = 432/472 nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Size: 250 mg
Catalog Number: 103010-898
Supplier: Anaspec Inc


Description: SensoLyte* 520 TEV Activity Assay Kit *Fluorimetric*, Components: 5-FAM /QXL* 520 ADAM10 substrate 50uL, 5-FAM 100 uM, 10 uL, TEV Protease, Recombinant 2 ?G X 4 vials, 10 uL, Assay Buffer 30 mL, DTT, 1M 30 uL, Optimized Performance, Enhanced Value
Catalog Number: 103010-670
Supplier: Anaspec Inc


Description: HiLyte* Fluor 594 hydrazide-TFA Salt, alternative to Alexa Fluor* 594 and DyLight Fluor* 594, Spectral characteristics similar to Texas Red, MW: 879.93, Spectral Properties: Abs/Em = 593/616 nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103010-962
Supplier: Anaspec Inc


Description: [Glu1]-Fibrinopeptide B, Purity: HPLC >/- 95%, Molecular Weight: 1570.6, Sequence: H-Glu-Gly-Val-Asn-Asp-Asn-Glu-Glu-Gly-Phe-Phe-Ser-Ala-Arg-OH, Appearance: Lyophilized white powder, This peptide is derived from fibrinopeptide B amino acid residues 1-14, Size: 1 mg
Catalog Number: 103003-184
Supplier: Anaspec Inc


Description: LCMV GP61, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2276.5, Sequence: GLNGPDIYKGVYQFKSVEFD, An H-2Db restricted epitope, this peptide is amino acids 61 to 80 fragment of the lymphocytic choriomeningitis virus (LCMV), Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-236
Supplier: Anaspec Inc


Description: Psi - RACK, epsilon - C2/V1 (82 - 92), epsilon PKC (82 - 92), C2 Domain, Sequence: HDAPIGYD, Purity: HPLC >/= 95%, e-PKC specific activator, it also activates MARCKS phosphorylation, Molecular Weight: 886.9, Size: 1 mg
Catalog Number: 103007-230
Supplier: Anaspec Inc


Description: Staphylococcal Enterotoxin B Domain (SEB) (144-153), Sequence: KKKVTAQELD, Purity: By HPLC >/= 95%, peptide is Staphylococcal Enterotoxin B domain (SEB) amino acid residue 163-172, Molecular Weight: 1159.4, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-764
Supplier: Anaspec Inc


Description: Beta-Amyloid (12-28), Human, Purity: HPLC >/= 95%, Molecular Weight: 1955.2, Sequence: H-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH, Appearance: Lyophilized white powder, residues are the binding site for apolipoprotein E, Size: 1mg
Catalog Number: 102996-482
Supplier: Anaspec Inc


Description: ClearPoint* beta-Amyloid (1-40), 13C, 15N - labeled at Arg & Lys, Human, Sequence: DAEF-R*-HDSGYEVHHQ-K*-LVFFAEDVGSN-K*-GAIIGLMVGGVV, Purity: By HPLC >/= 95%, All Arginine and Lysines have universally labeled, Molecular Weight: 4355.9, Size: 50 ug
Catalog Number: 103007-698
Supplier: Anaspec Inc


Description: SMCC Activated B - PE (B - Phycoerythrin), a fluorescent protein from phycobiliprotein family, is isolated from cyanobacteria and eukaryotic algae, SMCC activated B-PE is chemically modified with SMCC, reacts with the primary amine on B-PE, Storage: 4 deg C, Size: 1 mg
Catalog Number: 103010-440
Supplier: Anaspec Inc


Description: Streptavidin, Recombinant, Streptavidin is a nonglycosylated tetrameric protein that binds biotin noncovalently and with high affinity, was expressed in E. Coli, It shows one major band about 56 kDa on SDS-PAGE, Apperance: Lyophilized powder, size: 500 mg
Catalog Number: 103010-564
Supplier: Anaspec Inc


Description: SensoLyte* GST Activity Assay Kit *Fluorimetric*, Components: GST Substrate 1 vial, GST Standard 10 U/mL, 40 uL, Assay buffer 50 mL, Reduced Glutathione 20 mM, 300 uL, DMSO 100 uL, Optimized Performance, Enhanced Value, Assured Reliability, storage: -20 deg C
Catalog Number: 103010-518
Supplier: Anaspec Inc


Description: Suc-LLVY-AMC, fluorogenic substrate, Sequence: Suc-LLVY-AMC, Purity: By HPLC >/= 95%, used as a fluorogenic substrate for 20S proteasome, calpains and other chymotrypsin-like proteases, Molecular Weight: 763.9, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103007-798
Supplier: Anaspec Inc


465 - 480 of 2,094