Description: OVA (257-264), amide, Sequence: SIINFEKL-NH2, Purity: By HPLC >/= 95%, octameric peptide is amino acids 257 to 264 amidated fragment of ovalbumin (OVA), a class I (Kb)-restricted peptide epitope of OVA, Molecular Weight: 962.2, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103007-400

Supplier: Anaspec Inc

Sale

Description: QXL*570 acid, Molecular Weight: 597.77, Solvent System DMSO or DMF, dyes are the optimized quenchers for quenchers for rhodamines and Cy3 fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of TAMRA, sulforhodamine B, ROX and Cy3, size: 10 mg

Catalog Number: 103010-226

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (2 - 42), Human, Purity: Peak Area By HPLC Greater than or equal to 95%, Molecular Weight: 4399, Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103000-896

Supplier: Anaspec Inc

Sale

Description: CHRG01; Human Beta -Defensin 3 (hBD3) Derivative, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1661.9, Sequence: KSSTRGRKSSRRKK, derived from human defensin 3 (hBD3) C-terminal amino acids 54-67, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-580

Supplier: Anaspec Inc

Sale

Description: CEF20, Cytomegalovirus, CMV pp65 (495 - 503), HLA-A*0201-restricted epitope from Cytomegalovirus pp65 (495-503), Molecular Weight: 943.2, Sequence: NLVPMVATV, Physical State: Solid, Store away from oxidizing agent. Storage: -20 deg C, Size: 1 mg

Catalog Number: 103000-710

Supplier: Anaspec Inc

Sale

Description: [Arg(Me2s)3] - Histone H4 (1-21) - GGK(Biotin); H4R3(Me2s) (1-21), Purity: HPLC >/= 95%, Molecular weight: 2630.1, Sequence One-Letter Code/Three-Letter Code: [Ac-SG-R(me2s)-GKGGKGLGKGGAKRHRKV-GGK(biotin)] Store: -20 deg C, Size: 1mg

Catalog Number: 103009-696

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 532 acid (HiLyte* Fluor series), with fluorescence excitation and emission of Approx 545 nm and Approx 565 nm, Molecular Weight: 778.34, Spectral Properties: Abs/Em = 545/565 nm, Solvent System: Water, Physical State: Solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103011-408

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me2), amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2750.2, Sequence: ARTKQTAR-K(Me2)-STGGKAPRKQLA-GGK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-350

Supplier: Anaspec Inc

Sale

Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102999-616

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2751.2, Sequence: ART - K(Me2) - QTARKSTGGKAPRKQLA - GGK(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-086

Supplier: Anaspec Inc

Sale

Description: Neurogranin 28-43 [AAKIQASFRGHMARKK], Biotinylated-LC, Purity: HPLC >/= to 95%, Molecular Weight: 2139.6, Sequence: Biotin-LC-Ala-Ala-Lys-Ile-Gln-Ala-Ser-Phe-Arg-Gly-His-Met-Ala-Arg-Lys-Lys-OH, Appearance: Solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-878

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2764.2, Sequence: ARTKQTAR-K(Me3)-STGGKAPRKQLAGG-K(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-354

Supplier: Anaspec Inc

Sale

Description: GSK3 Substrate, a, b subunit, Purity: HPLC >/- 95%, Molecular Weight: 2631.8, Sequence: RAAVPPSPSLSRHSSPHQSEDEEE, Appearance: White Powder, This is a GSK-3 substrate, it can be used as a substrate for both alpha and beta isoforms of GSK3, Size: 1 mg

Catalog Number: 103003-268

Supplier: Anaspec Inc

Sale

Description: Glucagon (1-29), bovine, human, porcine, Purity: HPLC >/- 95%, Molecular Weight: 3841.1, Sequence: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT, label: FAM, Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, Size:1 mg

Catalog Number: 103003-074

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)12]-Histone H4(1-21)-GGK(Biotin), H4K12(Me3), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2644.1, Sequence: Ac-SGRGKGGKGLG-K(Me3)-GGAKRHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-644

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate XV, Purity: % Peak Area By HPLC >/= 95%, MW: 1647.7, Sequence: (One-Letter Code): QXL* 520 -Y-Abu-PQGL-Dab(5-FAM)-AK-NH2 A sensitive substrate for assaying MMP-1, 2, 7, 8, 12, 13 and 14 activities, Abs/Em = 494/521 nm, Size: 0.1 mg

Catalog Number: 103005-944

Supplier: Anaspec Inc

Sale