You Searched For: Hytest Ltd

Description: Recombinant Protein A-Biotin, Purity: >95% by SDS-PAGE, Protein A is a non-glycosylated cell-wall protein of Staphylococcus aureus that can bind Fc part of immunoglobulin molecule of different species with strong affinity, Storage: 4 deg C, size: 5 mg

Catalog Number: 103010-690

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 440 Cathepsin B Assay Kit *Fluorimetric*, Components: Cathepsin B substrate 1 mM, 50 ul, AMC 1 mM, 10 uL, Cathepsin B enzyme 5 uL, Assay Buffer 20 mL, Cathepsin B inhibitor Ac-LVK-CHO 100 uM, 10 uL, DTT 1 M, 100 uL, storage: -20 deg C

Catalog Number: 103010-534

Supplier: Anaspec Inc

Sale

Description: Fibrinogen Binding Inhibitor Peptide, Purity: HPLC >/- 95%, Molecular Weight: 1190.3, Sequence: H-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val-OH, is important for platelet aggregation, The sequence is derived from the carboxy terminus, Size: 1 mg

Catalog Number: 103003-350

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 11), Human, DAEFRHDSGYE, Purity: Peak Area By HPLC greater than or equal to 95%, Physical State: Solid, Molecular Weight: 1325.3, Storage: -20 deg C, size: 1mg

Catalog Number: 102999-348

Supplier: Anaspec Inc

Sale

Description: Recombinant human MOG (1 - 125), Source: E.Coli, Purity: Greater than 95% as determined by SDS-PAGE, Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL) assay, Storage: 2-4 degree Celcius, Size: 500ug

Catalog Number: 102998-100

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Glutathione Cellular Assay Kit *Fluorimetric*, Components: GSH detection reagent 1 vial, Reduced Glutathione standard 10 mM, 100 uL, Assay Buffer 50 mL, GST enzyme 50U/mL, 200 uL, GST enzyme 50U/mL, 200 uL, storage: -20 deg C

Catalog Number: 103010-520

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid Peptide (1-40), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4233.8, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-660

Supplier: Anaspec Inc

Sale

Description: Recombinant Human Tau (Tau-441) Protein, GST tagged at the N-terminal, Microtubule associated protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, 71.8 kDa, Application: In vitro phosphorylation, Storage: 2-4 degree C, Size: 50ug

Catalog Number: 103001-726

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)40]-Ac-a-Tubulin (29-50)-WGK(Biotin); TubK40(Ac)-WGK, Purity: HPLC >/= 95%, MW: 2918.2, Sequence: [Ac-GIQPDGQMPSD-K(ac)-TIGGGDDSFNWG-K(biotin)], with a C-terminal WG linker followed by a biotinylated lysine. Biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-516

Supplier: Anaspec Inc

Sale

Description: PKTPKKAKKL, Purity: Greater than or equal to 95%(HPLC), Molecular weight: 1138.5, Sequence: H-Pro-Lys-Thr-Pro-Lys-Lys-Ala-Lys-Lys-Leu-OH (3-letter code), derived from histone H1 peptide sequence, It is an effective CDK5 substrate (Km = 40 uM), Storage: At -20 Degree C, Size: 1mg

Catalog Number: 103002-946

Supplier: Anaspec Inc

Sale

Description: MBP (68–86), Myelin Basic Protein (68–86), Sequence: YGSLPQKSQRSQDENPV, Purity: By HPLC greater than or equal to 95%, myelin basic protein encephalitogenic epitope used to induce EAE, Molecular Weight: 1933.1, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-188

Supplier: Anaspec Inc

Sale

Description: West Nile Virus NS3 Protease, recombinant, Concentration: 100 ug/ml, is a member of the flavivirus genus, which contains many significant human pathogens including Dengue virus, positive sense 11kb RNA genome, Storage: -80 deg C, size: 5 ug

Catalog Number: 103010-404

Supplier: Anaspec Inc

Sale

Description: 5(6)-FAM [[5-(and-6)-Carboxyfluorescein] *UltraPure Grade* *Mixed Isomers*], Purity: >90% purity HPLC, Molecular Formula: C21H12O7, Molecular Weight: 376.32, Appearance: Orange solid, Solvent System DMF or DMSO, used to prepare fluoresceinated bioconjugates, size: 25 g

Catalog Number: 103010-752

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 750 acid, SE, longest-wavelength amine-reactive, Spectrally similar to Cy7 dye, MW: 1328.75, Spectral Properties: Abs/Em = 754/778 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Store away from oxidizing agent, Size: 1 mg

Catalog Number: 103010-946

Supplier: Anaspec Inc

Sale

Description: Histone H1-derived Peptide, phosphorylated by protein kinase A, substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): GGGPATPKKAKKL, MW: 1252.5, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-968

Supplier: Anaspec Inc

Sale

Description: CKS-17 (dimer), MN10021, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4088.8, Sequence: LQNRRGLDLLFLKEGGLC (dimer), dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (cysteine-disulfide linkage), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-252

Supplier: Anaspec Inc

Sale