You Searched For: Hytest Ltd

Description: 5(6) - TAMRA, Special Formulation, Synonym: 5-(and-6)-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/565 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 100 mg

Catalog Number: 103010-828

Supplier: Anaspec Inc

Sale

Description: Angiotensin II, peptide human, Purity: HPLC >/= to 95%, Molecular Weight: 1046.2, Sequence: H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH, Appearance: Lyophilized white powder, exerts a wide range of effects on the cardiovascular system, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-066

Supplier: Anaspec Inc

Sale

Description: AnaTag* 5 - TAMRA Protein Labeling Kit *Ultra Convenient* Components: 5-TAMRA, SE 3 vials, Reaction buffer: 0.5 mL, Desalting column 3 Pre-packed columns, DMSO 1 Ml, 10X Elution buffer 30 mL, One conjugation reaction can label up to 5 mg protein

Catalog Number: 103010-382

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)56]-Histone H3 (44-63), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2444.9, Sequence: GTVALREIRRYQ-K(Ac)-STELLIR, peptide is histone H3 (amino acid 44-63) with acetylation at Lys56, Storage: -20 degree C, Size: 1mg

Catalog Number: 103009-034

Supplier: Anaspec Inc

Sale

Description: Bak BH3, high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function, Purity: HPLC >/=95%, Sequence (One-Letter Code): GQVGRQLAIIGDDINR, MW: 1724.9, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-878

Supplier: Anaspec Inc

Sale

Description: Colivelin, Synthesized to potentiate the neuroprotective effect of humanin (HN), Colivelin completely suppresses cell death induced by overexpressed Familial Alzheimer's disease, Sequence: SALLRSIPAPAGASRLLLLTGEIDLP, Purity: By HPLC >/= 95%, Molecular Weight: 2645.1, Size: 1 mg

Catalog Number: 103007-098

Supplier: Anaspec Inc

Sale

Description: bisbenzimide H-33342 trihydrochloride (Hoechst 33342) 20 mM in water ≥95% (by HPLC, TLC)

Catalog Number: 103011-142

Supplier: Anaspec Inc

Sale

Description: Endothelin 1, human, porcine, Purity: HPLC >/= to 95%, Molecular Weight: 2492, Sequence: H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-HisLeu-Asp-Ile-Ile-Trp-OH, Appearance: Lyophilized white powder, is a potent vasoconstrictor peptide,, Size: 1 mg

Catalog Number: 102996-308

Supplier: Anaspec Inc

Sale

Description: Thrombin Receptor Agonist, amide (SFLLR-NH2), Purity: HPLC >/- 95%, MW: 634.1, Sequence: H-Ser-Phe-Leu-Leu-Arg-NH2, A protease-activated receptor agonist peptide identified as the minimal structural motif required for retaining the full agonist activity, Size: 5 mg

Catalog Number: 103003-346

Supplier: Anaspec Inc

Sale

Description: Dihydrorhodamine 123, Generic substrate for fluorimetric detection of oxidases (including peroxidase) in mitochondria, Molecular Weight: 346.38, Spectral Properties: Abs/Em = 507/529 nm, Solvent System: DMSO, CAS number: 109244-58-8, MF: C21H18N2O3, Size: 10 mg

Catalog Number: 103011-336

Supplier: Anaspec Inc

Sale

Description: Congo Red, UltraPure Grade, Early diagnosis and classification of amyloid deposition, Molecular Weight: 696.7, Spectral Properties: Abs/Em = 497/NA nm, Solvent System: Water, CAS number: 573-58-0, Molecular formula: C32H22N6Na2O6S2, Physical State: Solid, Storage: -20 deg C, Size: 1 g

Catalog Number: 103011-118

Supplier: Anaspec Inc

Sale

Description: EGF Receptor Substrate 2 [DADE - pY - LIPQQG], Biotinylated, derived from an autophosphorylation site (Tyr992) of EGFR, Purity: Peak Area By HPLC >/= 95%, MW: 1556.6, Sequence (One-Letter Code): Biotin-DADE-pY-LIPQQG, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103004-434

Supplier: Anaspec Inc

Sale

Description: Myristolated PKC Zeta, Pseudosubstrate (ZIP), Sequence: Myr-SIYRRGARRWRKL, Purity: By HPLC >/= 95%, interacts with PKC family isoforms and disrupt conventional PKC targeting and translocation, Molecular Weight: 1928.5, Size: 1 mg

Catalog Number: 103007-624

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 390 ACE2 Activity Assay Kit, Fluorimetric, Contains: Mca/Dnp, ACE2 substrate 5mM, Mca fluorescence reference standard 1mM, Assay Buffer 20mL, Inhibitor of ACE2 100uM, Stop Solution 10mL, Storage: -20 deg C, Size: 100 Assay(96-well plate)

Catalog Number: 103008-964

Supplier: Anaspec Inc

Sale

Description: IRBP derived peptide, R16, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1473.6, Sequence: ADGSSWEGVGVVPDV, Appearance: Powder, IRBP (Interphotoreceptor retinoid binding protein) derived peptide, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-232

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-38), Human, Purity: HPLC >/= 95%, Molecular Weight: 4131.6, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-490

Supplier: Anaspec Inc

Sale