You Searched For: Hytest Ltd

Description: SPase I FRET Substrate, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1494.6, Sequence: Dabcyl-AGHDAHASET-Edans, type I signal peptidase substrate peptide labeled with EDANS/ DABCYL FRET pair contains a crucial cleavage, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-586

Supplier: Anaspec Inc

Sale

Description: gp91 ds-tat, Sequence: YGRKKRRQRRRCSTRIRRQL-NH2, Purity: By HPLC greater than or equal to 95%, peptide is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide, Molecular Weight: 2673.2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-746

Supplier: Anaspec Inc

Sale

Description: CREBtide [KRREILSRRPSYR], Purity: HPLC >/- 95%, Molecular Weight: 2075.3, Sequence: 5-FAM-Lys-Arg-Arg-Glu-Ile-Leu-Ser-Arg-Arg-Pro-Ser-Tyr-Arg-OH, label: 5-FAM, Appearance: Lyophilized yellow powder, is a synthetic substrate for PKA, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-138

Supplier: Anaspec Inc

Sale

Description: MBP (90-106) HLA-A*0201-restricted peptide derived from melanoma antigens encoded by MAGE-3, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): Ac-FFKNIVTPRTPPPSQGK-NH2, Molecular Weight: 1058.3, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-110

Supplier: Anaspec Inc

Sale

Description: Threonine Phosphopeptide,PKC Substrate 4, phosphorylated, Serine/threonine phosphatase substrate, Purity: % Peak Area By HPLC >/=95%, Molecular Weight 909, Sequence (One-Letter Code): KR-pT-IRR, Storage: -20 deg C, Size: 1mg

Catalog Number: 102998-170

Supplier: Anaspec Inc

Sale

Description: AMC [7-Amino-4-methylcoumarin], Molecular Formula: C10H9NO2, Molecular Weight: 175.2, Appearance: Solid, Coumarin 120; coumarin 440, Storage: -20 deg C, Size: 5 g

Catalog Number: 103003-518

Supplier: Anaspec Inc

Sale

Description: HA peptide, Purity: % Peak Area By HPLC >/=95%, belongs to the influenza hemagglutinin (HA) family, Molecular Weight 1102.2, Sequence(One-Letter Code) YPYDVPDYA, Storage -20 deg C, shipped at ambient temperature, Appearance: Lyophilized white powder, freely soluble in H2O, Size: 5mg

Catalog Number: 102998-834

Supplier: Anaspec Inc

Sale

Description: SHNG, [Gly14] - HN, [Gly14] - Humanin, Purity: By HPLC >/= 95%, MW: 2657.3, Sequence: (One-Letter Code): MAPRGFSCLLLLTGEIDLPVKRRA A more potent suppressor of neuronal cell death than humanin (HN), Physical State: White Powder, Size: 1 mg

Catalog Number: 103006-054

Supplier: Anaspec Inc

Sale

Description: Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK], 5 - TMR labeled peptide, Purity: HPLC >/= 95%, Sequence (Three-Letter Code) 5 - TMR - Lys - Val - Glu - Lys - Ile - Gly - Glu - Gly - Thr - Tyr - Gly - Val - Val - Tyr - Lys - OH, MW: 2082.5, Storage: -20degree C, Size: 1mg

Catalog Number: 102997-410

Supplier: Anaspec Inc

Sale

Description: LL-37, scrambled, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR, Molecular Weight: 4493.3, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-672

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)12]-Histone H4 (1-25)-GSGSK(Biotin); H4K12(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3274.8, Sequence: SGRGKGGKGLG-K(Ac)-GGAKRHRKVLRDNGSGS-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103009-046

Supplier: Anaspec Inc

Sale

Description: Cys(Npys)-TAT (47-57), cell penetrating and carrier peptide applicable in conjugation studies, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): C(Npys)YGRKKRRQRRR-NH2, MW: 1816.1, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-426

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid A4 Protein Precursor (740 - 770), APP (C31), Sequence: AAVTPEERHLSKMQQNGYENPTYKFFEQMQN, C31 peptide is a potent inducer of apoptosis, Molecular Weight: 3717.1, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-180

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)16]-Histone H4 (1-21)-GGK(Biotin), H4K16(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2644.1, Sequence: Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-536

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 532 hydrazide, carbonyl-reactive fluorescent labeling dye, with fluorescence excitation and emission maxima of Approx 545 nm and Approx 565 nm, Molecular Weight: 792.37, Spectral Properties: Abs/Em = 545/565 nm, Solvent System: Water or DMF, Size: 1 mg

Catalog Number: 103011-414

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2750.2, Sequence: ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-322

Supplier: Anaspec Inc

Sale