You Searched For: 6000pg

Description: Protease-Activated Receptor-1, PAR-1 Agonist, amide, Sequence: TFLLRN-NH2, Purity: By HPLC >/= 95%, proteinase activated receptor (PAR-1) belongs to a subfamily of G-protein coupled receptor, Molecular Weight: 761.9, Size: 5 mg

Catalog Number: 103007-558

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 MMP-1 Assay Kit *Fluorimetric*, Components: MMP-1 substrate 270 ul, EDANS 1 mM, 10 ul, APMA, 4-aminophenylmercuric acetate 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Enhanced Value, High Speed, storage: -20 deg C

Catalog Number: 103010-150

Supplier: Anaspec Inc

Sale

Description: Cathepsin K substrate, Sequence: Abz - HPGGPQ - EDDnp, Purity: By HPLC greater than or equal to 95%, FRET peptide can be used to monitor selectively cathepsin K activity in physiological fluids, Molecular Weight: 920, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-314

Supplier: Anaspec Inc

Sale

Description: Penetratin-Arg, Purity: HPLC >/= 95%, MW: 2358.8, Sequence: RQIRIWFQNRRMRWRR] Penetratin-Arg is a cell-penetrating peptide (CPP) that is derived from the 3rd helix of Drosophila Antennapedia homeodomain protein. Apperance: Off white solid, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-970

Supplier: Anaspec Inc

Sale

Description: Chlorotoxin (Cltx), Purity: >/= 95%, MW: 3996, Sequence: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35) A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus, Appearance: Lyophilized white powder, Size: 0.1 mg

Catalog Number: 103005-970

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate XIV, Purity: By HPLC >/= 95%, MW: 1913.1, Sequence: (One-Letter Code): QXL* 520 -Y-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)substrate for assaying MMP-1, 2, 3, 7, 8, 9, 12, and 13 activities, Size: 0.1 mg

Catalog Number: 103005-942

Supplier: Anaspec Inc

Sale

Description: Peptide Substrate for Renin 520 Assay kit, Purity: HPLC greater than or equal to 95%, Molecular Weight: 2000 - 2200, Appearance: Lyophilized red powder, for screening of renin inhibitors, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103007-076

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Plus 520 MMP-9 Assay Kit *Fluorimetric*, Components: MMP-9 antibody 12 X 8 black strips, MMP-9 STD 10 u
g/mL, 10 ul, MMP dilution buffer 10 mL, 10 X Wash buffer 50 mL, APMA 100 mM, 150 ul, MMP-1 substrate 50 ul, Assay buffer 50 mL, Stop Solution 10 mL

Catalog Number: 103010-290

Supplier: Anaspec Inc

Sale

Description: Human MMP - 8, Concentration: 10 ug/mL, Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components, It can be used as a positive control, Storage: -80 deg C, size: 100 uL

Catalog Number: 103010-284

Supplier: Anaspec Inc

Sale

Description: 5-TMRIA, Synonym: Tetramethylrhodamine-5-iodoacetamide, thiol-selective reactive dyes, used to label proteins via the cysteine residues, Molecular Weight: 569.39, Spectral Properties: Abs/Em = 541/567 nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Physical State: Solid, Size: 5mg

Catalog Number: 103010-986

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 MMP Profiling Kit *Fluorimetric*, Components: Microplate pre-coated with 16 different MMP substrates 2 identical 96-well plates, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 100 ul, Assay buffer 40 mL, Stop solution 20 mL, storage: -20 deg C

Catalog Number: 103010-164

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 532 C2 maleimide, thiol-reactive fluorescent labeling dye, with fluorescence excitation and emission maxima of 545 nm and 565 nm, MW: 900.39, Spectral Properties: Abs/Em = 545/565 nm, Solvent System: Water or DMF, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103011-412

Supplier: Anaspec Inc

Sale

Description: Substance P, Purity: HPLC >/= 95%, Molecular Weight: 1347.7, Sequence: H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2, Appearance: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-504

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)4]-Histone H3 (1-21), H3K4(Me3), Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA, Purity: By HPLC >/= 95%, peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-4, Molecular Weight: 1188.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-966

Supplier: Anaspec Inc

Sale

Description: ACTH (1 - 10), Centrally administered N-terminal fragments of ACTH(1-10, 4-10, 4-9), Purity % Peak Area By HPLC >/=95%, Storage: -20 degree Celcius, Physical State: Powder, Sequence (One-Letter Code): SYSMEHFRWG, Molecular Weight: 1299.4,Physical State Powder Size: 5mg

Catalog Number: 102998-434

Supplier: Anaspec Inc

Sale

Description: Biotin - beta - Amyloid (1 - 40), Human, label: FAM, Purity: HPLC >/- 95%, Molecular Weight: 4556.2, Appearance: Lyophilized white powder, Sequence: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, FAM is preferred over FITC, Storage -20 deg C, size: 0.1 mg

Catalog Number: 103003-542

Supplier: Anaspec Inc

Sale