You Searched For: Hytest Ltd

Description: Histone H4 (1 - 20), PRMT7 Substrate, M1, Sequence: SGRGKGGKGLGKGGAKRHRK - NH2, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1991.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-370

Supplier: Anaspec Inc

Sale

Description: S. pneumoniae CFP10 (71–85)

Catalog Number: 103006-902

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)36]-Histone H3 (31-41), H3K36(Me1), Sequence: STGGV-K(Me1)-KPHRY, Purity: By HPLC >/= 95%, This peptide is Histone H3 amino acid residues 31 to 41 mono-methylated at Lys-36, Molecular Weight: 1243.4, Storage: -20 C, Size: 1 mg

Catalog Number: 103008-036

Supplier: Anaspec Inc

Sale

Description: Hoechst 33258, 20 mM solution in water, CAS: 23491-45-4, Cell-permeant DNA minor groove binding dye, MW: 533.88, Spectral Properties: Abs/Em = 352/461 nm, MF: C25H24N6O.3HCl.5H2O, Appearance: Yellow liquid, Storage: -20 deg C Store away from oxidizing agent, Size: 5 ml

Catalog Number: 103011-144

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 750 C2 maleimide, Spectrally similar to Cy7 dye, longest-wavelength thiol-reactive HiLyte* Fluor dye, Molecular Weight: 1222.5, Spectral Properties: Abs/Em = 754/778 nm, Solvent System: Water or DMF, Physical State: Solid, Storage -20C, Size: 1 mg

Catalog Number: 103010-952

Supplier: Anaspec Inc

Sale

Description: 5(6) - CFDA, SE, Synonym: 5 - (and - 6) - Carboxyfluorescein diacetate, succinimidyl ester Mixed Isomers; 5(6) - CFDA, NHS ester, Reactive pH indicator for slightly acidic pH range, MW: 557.5, Spectral Properties: Abs/Em = 492/517 nm, Solvent System: DMSO, Size: 25 mg

Catalog Number: 103011-388

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 488 acid, SE, amine-reactive fluorescent labeling dye, Synonym: HiLyte* Fluor 488 acid, NHS ester, Molecular Weight: 698.6, Spectral Properties: Abs/Em = 502/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103010-876

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (40 - 1), Human, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4329.9, Peptide Reconstitution: B-Amyloid (40-1) peptide is freely soluble in DMSO, Storage: –20 deg C or lower, Size: 0.5 mg

Catalog Number: 102999-344

Supplier: Anaspec Inc

Sale

Description: [Arg6]-beta-Amyloid (1-40), English Mutation, Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC greater than or equal to 95%, amino acids 1 to 42 beta-amyloid with the England mutation, Molecular Weight: 4533.2, Size: 0.5 mg

Catalog Number: 103007-606

Supplier: Anaspec Inc

Sale

Description: Human Sirtuin 2, Recombinant, Sirtuins comprise a unique class of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases (class III HDACs) targeting multiple protein substrates, belongs to the family of Sir2, Storage: -80 deg C, Size: 10 ug

Catalog Number: 103010-584

Supplier: Anaspec Inc

Sale

Description: EMP17, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2483.9, Sequence: (One-Letter Code) FITC-LC-TYSCHFGPLTWVCKPQGG, fluorescent (FITC)-labeled Erythropoietin (EPO)-mimetic peptide (EMP17), Abs/Em=494/520 nm, Storage: At -20 Degree C, Size: 1mg

Catalog Number: 103002-744

Supplier: Anaspec Inc

Sale

Description: GRGDS, AnaSpec

Catalog Number: 103006-344

Supplier: Anaspec Inc

Sale

Description: Srctide, Sequence: GEEPLYWSFPAKKK-NH2, Purity: By HPLC greater than or equal to 95%, peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Molecular Weight: 1678, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-838

Supplier: Anaspec Inc

Sale

Description: Fluorescein-5-thiosemicarbazide

Catalog Number: 103011-026

Supplier: Anaspec Inc

Sale

Description: EndoFree Recombinant Human alpha-Synuclein Protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, Thioflavin T assay, Application: Fibrillation, oligomerization, cell toxicity studies, Storage: 2-4 degree C, Size: 1000ug

Catalog Number: 103001-644

Supplier: Anaspec Inc

Sale

Description: Indo-1, AM, Emission-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration, Molecular Weight: 1009.9, Spectral Properties: Abs/Em = 346/475 nm, Solvent System: DMSO, Molecular Formula: C47H51N3O22C47H51N3O22, CAS number: 112926-02-0, Size: 1 mg

Catalog Number: 103011-166

Supplier: Anaspec Inc

Sale