You Searched For: Hytest Ltd

Description: BNP-32, human, Purity: HPLC >/= to 95%, Molecular Weight: 3464.1, Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, Appearance: Lyophilized white powder, It is also called the brain natriuretic peptide because it was first identified in porcine brain, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-422

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me3), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2765.2, Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin), Label: Biotin, Histone H3, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-090

Supplier: Anaspec Inc

Sale

Description: Human [Arg6]-beta-Amyloid (1-40)

Catalog Number: 103007-602

Supplier: Anaspec Inc

Sale

Description: Mouse pVEC (Cadherin-5)

Catalog Number: 103009-972

Supplier: Anaspec Inc

Sale

Description: Microscale Protein Labeling Kit AnaTag™ AMCA - X 'Ultra Convenient'

Catalog Number: 103010-368

Supplier: Anaspec Inc

Sale

Description: Sulforhodamine 101 cadaverine

Catalog Number: 103011-036

Supplier: Anaspec Inc

Sale

Description: Gila Exendin 4

Catalog Number: 103003-724

Supplier: Anaspec Inc

Sale

Description: Human Recombinant MMP-12 (from <i>E. coli</i>)

Catalog Number: 103001-346

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (1-42), FAM (Carboxyfluorescein)

Catalog Number: 102999-614

Supplier: Anaspec Inc

Sale

Description: Pyrrhocoricin, Sequence: VDKGSYLPRPTPPRPIYNRN, Purity: By HPLC greater than or equal to 95%, proline-rich cationic antibacterial peptide pyrrhocoricin kills responsive bacteria, Molecular Weight: 2340.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-416

Supplier: Anaspec Inc

Sale

Description: Big Endothelin-1 (1-38), human, Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11), Purity: By HPLC >/= 95%, Big Endothelin-1 (1-38) is precursor of endothelin 1, Molecular Weight: 4283, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-562

Supplier: Anaspec Inc

Sale

Description: MUC5AC 3 glycopeptide is a 16-amino acid modified fragment of mucin 5/MUC5AC, where T* is a GalNac labeled threonine 3, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): GT-T*-PSPVPTTSTTSAP, Molecular Weight: 1703.9, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-584

Supplier: Anaspec Inc

Sale

Description: Fibrinopeptide B, human, Purity: HPLC >/- 95%, MW: 1553.6, Sequence: Pyr-Gly-Val-Asn-Asp-Asn-Glu-Glu-Gly-Phe-Phe-Ser-Ala-Arg-OH, Appearance: Powder, is an N-terminal modified peptide with pyroglutamylation, Size: 1 mg

Catalog Number: 103003-348

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 440 West Nile Virus Protease Assay Kit*Fluorimetric*, Components: Pyr-RTKR-AMC, WNV protease substrate 5mM DMSO, AMC 5 mM DMSO solution, 10 uL, Assay Buffer 2 x 50 mL, WNV Protease Inhibitor undeca-D-ArgNH2 1 mM DMSO solution, 10 uL

Catalog Number: 103010-398

Supplier: Anaspec Inc

Sale

Description: Delta - Toxin (1 - 26), Staphylococcus aureus, Sequence: MAQDIISTIGDLVKWIIDTVNKFTKK, Purity: By HPLC greater than or equal to 95%, 26-residue hemolytic peptide secreted by Staphylococcus aureus, Molecular Weight: 2978.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-368

Supplier: Anaspec Inc

Sale

Description: Kemptide [LRRASLG], 5 - FAM labeled peptide, phosphate acceptor peptide, Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code) 5 - FAM - Leu - Arg - Arg - Ala - Ser - Leu - Gly - OH, Molecular Weight: 1130.2, Storage: -20degree C, Size: 5mg

Catalog Number: 102997-406

Supplier: Anaspec Inc

Sale