Print…

You Searched For: Hytest Ltd


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-103007-586

Enterokinase Substrate 1 mg

Description: Enterokinase Substrate, Sequence: GDDDDK-BNA, Purity: By HPLC greater than or equal to 95%, This peptide is an enterokinase substrate also known as enteropeptidase, Molecular Weight: 788.8, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-586
Supplier: Anaspec Inc
Image Unavailable-103007-220

Steroid Receptor Coactivator - 1 (SRC - 1) 1 mg

Description: Steroid Receptor Coactivator - 1 (SRC - 1), biotin labeled, Sequence: Biotin - CPSSHSSLTERHKILHRLLQEGSPS, 676 to 700 fragment of steroid receptor co-activator (SRC1), Molecular Weight: 3026.5, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-220
Supplier: Anaspec Inc
Image Unavailable-103006-682

PDKtide 1 mg

Description: PDKtide peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1), Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, Molecular Weight: 4771.4, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-682
Supplier: Anaspec Inc
Image Unavailable-103010-758

5-FAM 5g

Description: 5-FAM, single isomer, Synonym: 5-Carboxyfluorescein, Molecular Weight: 376.32, Molecular Formula: C21H12O7, Appearance: Orange solid, Purity: >95% (TLC), >95% (HPLC), Spectral Properties Abs/Em = 492/518 nm, Solvent System DMF or DMSO, Storage: -20 deg C desiccated, Size: 5g
Catalog Number: 103010-758
Supplier: Anaspec Inc
Image Unavailable-103004-134

Charybdotoxin 0.1 mg

Description: Charybdotoxin, ChTX is a Ca2+-activated K+ channel blocker, t depolarizes peripheral T lymphocytes and blocks their mitogen-induced proliferation, Purity: Peak Area By HPLC >/= 95%, Appearance: Lyophilized white powder, MW: 4296.0, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103004-134
Supplier: Anaspec Inc
Image Unavailable-103005-944

520 MMP FRET Substrate XV 0.1 mg

Description: 520 MMP FRET Substrate XV, Purity: % Peak Area By HPLC >/= 95%, MW: 1647.7, Sequence: (One-Letter Code): QXL* 520 -Y-Abu-PQGL-Dab(5-FAM)-AK-NH2 A sensitive substrate for assaying MMP-1, 2, 7, 8, 12, 13 and 14 activities, Abs/Em = 494/521 nm, Size: 0.1 mg
Catalog Number: 103005-944
Supplier: Anaspec Inc
Image Unavailable-103010-208

Oxonol VI

Description: Oxonol VI
Catalog Number: 103010-208
Supplier: Anaspec Inc
Image Unavailable-103010-850

5-TAMRA, SE 100mg

Description: 5-TAMRA, SE, Synonym: 5-Carboxytetramethylrhodamine, succinimidyl ester; 5-TAMRA, NHS ester, for labeling proteins, single isomers for labeling peptides, nucleotides, Molecular Weight: 527.53, Molecular Formula: C29H25N3O7, Spectral Properties: Abs/Em = 547/574 nm, Size: 100mg
Catalog Number: 103010-850
Supplier: Anaspec Inc
Image Unavailable-102996-424

BNP-32 1 mg

Description: BNP-32, human, Purity: HPLC >/= to 95%, Molecular Weight: 3464.1, Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, Appearance: Lyophilized white powder, It is also called the brain natriuretic peptide because it was first identified in porcine brain, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-424
Supplier: Anaspec Inc
Image Unavailable-102997-814

SensoLyte* Anti - MOG(35 - 55) IgG Quantitative ELISA Kit 96 assays

Description: SensoLyte* Anti - MOG(35 - 55) IgG Quantitative ELISA Kit (mouse/rat), Contains: Pre-coated and pre-blocked 96-well strip plate, Standard for calibration, A detailed protocol, Storage: 4degree C, Size: 96 assays
Catalog Number: 102997-814
Supplier: Anaspec Inc
Image Unavailable-103003-370

HNP-1 0.1 mg

Description: HNP-1, Defensin Human Neutrophil Peptide-1, Purity: HPLC >/- 95%, Molecular Weight: 3442.1, Sequence: ACYCRIPACIAGERRYGTCIYQGRLWAFCC, Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine, Size: 0.1 mg
Catalog Number: 103003-370
Supplier: Anaspec Inc
Image Unavailable-103008-976

SensoLyte* Rh110 Matriptase Activity Assay Kit

Description: SensoLyte* Rh110 Matriptase Activity Assay Kit, Fluorimetric, Contains: Rh110 Matriptase substrate, Rh110 fluorescence reference standard, Matriptase, human recombinant, Assay Buffer, Leupeptin, Storage: -20 degree C, Size: 100 Assays (96-well plate)
Catalog Number: 103008-976
Supplier: Anaspec Inc
Image Unavailable-103011-172

Fura-2, AM 1 mg

Description: Fura-2, AM, Excitation-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration, Molecular Weight: 1001.9, Spectral Properties: Abs/Em = 363/512 nm, Solvent System: DMSO, CAS No: 108964-32-5, Molecular formula: C44H47N3O24, Storage -20 deg C, Size: 1 mg
Catalog Number: 103011-172
Supplier: Anaspec Inc
Image Unavailable-103005-826

TAT (47 - 57) 5 mg

Description: TAT (47 - 57), Purity: % Peak Area By HPLC >/= 95%, Molecular Weight: 1559.9, Sequence: (One-Letter Code): YGRKKRRQRRR the most characterized fragment of the HIV transactivator protein (TAT), Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103005-826
Supplier: Anaspec Inc
Image Unavailable-102996-258

PACAP (6-38) 0.5 mg

Description: PACAP (6-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4024.8, Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-258
Supplier: Anaspec Inc
Image Unavailable-103003-258

Melan-A/MART-1 (27-35) 1 mg

Description: Melan-A/MART-1 (27-35), Purity: HPLC >/- 95%, Molecular Weight: 814.6, Sequence: H-Ala-Ala-Gly-Ile-Gly-Ile-Leu-Thr-Val-OH, Appearance: Powder, Melan-A is a melanocyte differentiation antigen recognized by cytotoxic T lymphocytes, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-258
Supplier: Anaspec Inc
369 - 384 of 2,094