You Searched For: Hytest Ltd

Description: Magainin 1, Purity: HPLC >/= to 95%, Molecular Weight: 2409.9, Sequence: GIGKFLHSAGKFGKAFVGEIMKS, Appearance: Lyophilized white powde, it is peptide antibiotics with antibacterial and antiparasitic activities, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-126

Supplier: Anaspec Inc

Sale

Description: Cyclo ( - GRGDSP) N to C cyclized, Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code): Cyclo( - Gly - Arg - Gly - Asp - Ser - Pro), Molecular Weight: 569.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-350

Supplier: Anaspec Inc

Sale

Description: Crosstide Peptide, FAM (Carboxyfluorescein)

Catalog Number: 103005-930

Supplier: Anaspec Inc

Sale

Description: Chicken OVA-G4 Peptide

Catalog Number: 103008-044

Supplier: Anaspec Inc

Sale

Description: N-Succinimidyl 6-(2,4-Dinitroanilino)hexanoate ≥95%

Catalog Number: 103010-916

Supplier: Anaspec Inc

Sale

Description: Magainin 1

Catalog Number: 102996-124

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (1-40), HiLyte™ Fluor 488

Catalog Number: 103003-178

Supplier: Anaspec Inc

Sale

Description: Apidaecin IB, Sequence: GNNRPVYIPQPRPPHPRL, Purity: By HPLC >/= 95%, Apidaecin IB is an insect antimicrobial peptide showing a significant sequence homology and a common mechanism of action with drosocin, Molecular Weight: 2108.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-152

Supplier: Anaspec Inc

Sale

Description: Angiotensin II, human, TAMRA-labeled, Abs/Em = 541/565 nm, Purity: HPLC >/=95%, Sequence (One-Letter Code): TAMRA-DRVYIHPF, Sequence (Three-Letter Code): TAMRA-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH, MW: 1458.7, Form: Powder, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-390

Supplier: Anaspec Inc

Sale

Description: Bovine B-Casein, monophosphopeptide, for characterization of phosphorylated peptides in liquid chromatography, Purity: HPLC >/=95%, Sequence (1-Letter Code): FQ-pS-EEQQQTEDELQDK, MW: 2062, Form: Lyophilized white powder, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-364

Supplier: Anaspec Inc

Sale

Description: (Arg)9, biotin-labeled, Sequence: Biotin-LC-RRRRRRRRR-NH2, Purity: By HPLC >/= 95%, peptide sequence with nine arginines contains a biotin group attached to the epsilon amino group of lysine at the N-terminus, Molecular Weight: 1762.2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-820

Supplier: Anaspec Inc

Sale

Description: Somatostatin 28, human, sheep, cow, rat, mouse, pig, Purity: HPLC >/= to 95%, Molecular Weight: 3148.6, Sequence: SANSNPAMAPRERKAGCKNFFWKTFTSC, is a cyclic peptide existing in two isoforms and is produced in the pancreas islet, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-330

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Thiol Quantitation Assay Kit *Colorimetric*, Components: Thiol Detection Reagent 1 mL, Reduced Glutathione (GSH) Standard 10 mM, 100 uL, Assay Buffer 100 mL, Optimized Performance, Enhanced Value, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-476

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate IX, Purity: % Peak Area By HPLC >/= 95%, Molecular Weight: 1889.1, Sequence: (One-Letter Code): QXL* 520-RPLALWRK(5-FAM)-NH2 A sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm, Size: 0.1 mg

Catalog Number: 103005-932

Supplier: Anaspec Inc

Sale

Description: Gly22]-beta-Amyloid (1-40), Arctic Mutation, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV, Molecular weight: 4257.8, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.5 mg

Catalog Number: 103006-544

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Green Protease Assay Kit *Fluorimetric*, Components: Protease substrate 280 ul, Trypsin 5 U/ul, 100 ul, 2X Assay buffer 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-144

Supplier: Anaspec Inc

Sale