Print…

You Searched For: Hytest Ltd


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-103006-246

[Leu27] - Melan - A MART 1 (26 - 35) (ELAGIGILTV) 1 mg

Description: [Leu27] - Melan - A, MART 1 (26 - 35) (ELAGIGILTV), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Glu - Leu - Ala - Gly - Ile - Gly - Ile - Leu - Thr - Val - OH, MW: 985.8, Physical State: Solid, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-246
Supplier: Anaspec Inc
Image Unavailable-103006-992

Human Beta-Amyloid (1-34)

Description: Human Beta-Amyloid (1-34)
Catalog Number: 103006-992
Supplier: Anaspec Inc
Image Unavailable-103011-228

DiBAC4(3) 25 mg

Description: DiBAC4(3), Synonym: Bis-(1,3-dibutylbarbituric acid)trimethine oxonol, UltraPure Grade, Sensitive 488 nm-excitable membrane potential probe, MW: 516.6, Spectral Properties: Abs/Em = 493/516 nm, Solvent System: DMSO, Appearance: Red solid, Purity: > 95 % (HPLC), Size: 25 mg
Catalog Number: 103011-228
Supplier: Anaspec Inc
Image Unavailable-103001-238

Recombinant Rat MOG Protein

Description: Recombinant Rat MOG Protein, Source: E. Coli, Purity: Greater than 95% (SDS-PAGE), Endotoxin: Less than 0.1EU/1ug of the protein, Application: EAE induction and in vitro studies such as T cell proliferation, cytokine induction, WB, ELISA, Storage: Freezer, Size: 1000ug
Catalog Number: 103001-238
Supplier: Anaspec Inc
Image Unavailable-103007-830

Bcl-2 Binding Peptide Bad BH3 Peptide

Description: Bcl-2 Binding Peptide, Bad BH3 Peptide, Sequence: LWAAQRYGRELRRMSDEFEGSFKGL, Purity: By HPLC >/= 95%,
This is a bcl-2 binding peptide derived from the BH3 domain (a death domain) of Bad, amino acid residues 140 to 165, Molecular Weight: 3003.4, Size: 1 mg
Catalog Number: 103007-830
Supplier: Anaspec Inc
Image Unavailable-103009-158

[Lys(Ac)8]-Histone H4

Description: [Lys(Ac)8]-Histone H4 (1-25)-GSGSK; H4K8(Ac), Purity: HPLC >/= 95%, MW: 3274.8, Sequence: [SGRGKGG-K(Ac)-GLGKGGAKRHRKVLRDNGSGS-K(Biotin)], (1-25) with acetylation at Lys8, biotinylated through a C-terminal GSGSK linker. Biotin - labeled, Store: -20 deg C, Size: 1mg
Catalog Number: 103009-158
Supplier: Anaspec Inc
Image Unavailable-103010-358

AnaTag* HiLyte* Fluor 647 Protein Labeling Kit

Description: AnaTag* HiLyte* Fluor 647 Protein Labeling Kit *Ultra Convenient* Components: HiLyte Fluor*647 SE 3 vials, Reaction buffer 0.5 Ml, Desalting column 3 Pre-packed columns, DMSO 1 mL, 10X Elution buffer 30 ml, storage: 4 deg C
Catalog Number: 103010-358
Supplier: Anaspec Inc
Image Unavailable-102996-536

?-Endorphin 1 mg

Description: ?-Endorphin, human, Purity: HPLC >/= 95%, Molecular Weight: 3465.1, Sequence: H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-536
Supplier: Anaspec Inc
Image Unavailable-102971-774

Apelin - 16 Peptide, human, bovine

Description: Apelin - 16 Peptide, human, bovine, Purity: greater than or equal to 95% by HPLC, These are fragments resulting from maturation of preproapelin, potentially indicated as target therapeutics of eating disorder and obesity, Storage: -20 deg C, Size: 1mg
Catalog Number: 102971-774
Supplier: Anaspec Inc
Image Unavailable-102997-268

[Pyr3] - beta - Amyloid (3 - 40), Human 0.1 mg

Description: [Pyr3] - beta - Amyloid (3-40), Human, Purity: HPLC >/= 95%, Sequence (One-Letter Code) Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, MW: 4125.7, trigger formation of insoluble AB peptide deposits, inhibit secretion of APP, Storage: -20deg C, Size: 0.1mg
Catalog Number: 102997-268
Supplier: Anaspec Inc
Image Unavailable-103008-018

[Lys(Me2)4]-Histone H3 (1-10) H3K4(Me2) 1 mg

Description: [Lys(Me2)4]-Histone H3 (1-10), H3K4(Me2), Sequence: ART-K(Me2)-QTARKS, Purity: By HPLC greater than or equal to 95%, peptide is Histone H3 amino acid residues 1 to 10 di-methylated at Lys-4, Molecular Weight: 1174.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103008-018
Supplier: Anaspec Inc
Image Unavailable-103007-962

[Lys(Ac)9]-Histone H3 (1-21) H3K9(Ac) 1 mg

Description: [Lys(Ac)9]-Histone H3 (1-21), H3K9(Ac), Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQLA, Purity: By HPLC greater than or equal to 95%, peptide sequence is found in residues 1 to 21 of the histone H3K9(Ac), Molecular Weight: 2296.7, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-962
Supplier: Anaspec Inc
Image Unavailable-102999-764

Atrial Natriuretic Peptide (1 - 28) 0.5 mg

Description: Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled, Sequence: Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23), Purity: HPLC greater than or equal to 95%, Molecular Weight: 3308.8, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102999-764
Supplier: Anaspec Inc
Image Unavailable-102999-786

Cecropin B 0.5 mg

Description: Cecropin B, Sequence: KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2, Purity: HPLC greater than or equal to 95%, Molecular Weight: 3834.7, Apperance: Lyophilized white powder,Peptide Reconstitution: Cecropin B peptide is freely soluble in H2O, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102999-786
Supplier: Anaspec Inc
Image Unavailable-102999-330

Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human 0.5 mg

Description: Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 3297.7, Storage: -20 deg C, size: 0.5mg
Catalog Number: 102999-330
Supplier: Anaspec Inc
Image Unavailable-103006-686

OVA (257-264) FAM labeled 1 mg

Description: OVA (257-264), FAM labeled class I (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class I MHC molecule, H-2Kb, Purity: HPLC>/=95%, Sequence (One-Letter Code): 5-FAM-SIINFEKL-NH2, Molecular weight: 1320.5, Size: 1 mg
Catalog Number: 103006-686
Supplier: Anaspec Inc
337 - 352 of 2,094