You Searched For: Hytest Ltd

Description: 5-TAMRA, SE, Synonym: 5-Carboxytetramethylrhodamine, succinimidyl ester; 5-TAMRA, NHS ester, for labeling proteins, the single isomers for labeling peptides, nucleotides, Molecular Weight: 527.53, Molecular Formula: C29H25N3O7, Spectral Properties: Abs/Em = 547/574 nm, Size: 5mg

Catalog Number: 103010-848

Supplier: Anaspec Inc

Sale

Description: Kemptide [LRRASLG], Purity: HPLC >/= to 95%, Molecular Weight: 771.9, Sequence: H-Leu-Arg-Arg-Ala-Ser-Leu-Gly-OH, Appearance: Lyophilized white powder, Peptide Reconstitution: freely soluble in water, is a phosphate acceptor peptide, Storage: -20 deg C, Size: 25 mg

Catalog Number: 102996-282

Supplier: Anaspec Inc

Sale

Description: Beta-CGRP, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3793.4, Sequence: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7), 37-amino acid peptide is beta form of Calcitonin-gene-related peptide (Beta-CGRP), Storage: -20 degree C, Size: 0.5mg

Catalog Number: 103008-238

Supplier: Anaspec Inc

Sale

Description: 5-FAM, single isomer, Synonym: 5-Carboxyfluorescein, Molecular Weight: 376.32, Molecular Formula: C21H12O7, Appearance: Orange solid, Purity: >95% (TLC), >95% (HPLC), Spectral Properties Abs/Em = 492/518 nm, Solvent System DMF or DMSO, Storage: -20 deg C desiccated, Size: 100 mg

Catalog Number: 103010-754

Supplier: Anaspec Inc

Sale

Description: FITC-LC-TAT (47 - 57), Sequence (One-Letter Code): FITC-LC-YGRKKRRQRRR-NH2, Peptide Purity: >95%, Appearance: Lyophilized yellow powder, Molecular Weight: 2061.4, peptide contains a long chain (LC) to prevent FITC from degradation. Abs/Em = 493/522 nm, Size: 0.5 mg

Catalog Number: 103000-576

Supplier: Anaspec Inc

Sale

Description: Bak BH3 peptide, TAMRA-labeled, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2137.4, Sequence: 5-TAMRA-GQVGRQLAIIGDDINR, derived from the BH3 domain of Bak, has high-affinity binding to surface pocket of Bcl-XL protein, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-254

Supplier: Anaspec Inc

Sale

Description: GIP (3-42), human, potent antagonist as opposed to the agonist full length GIP on the GIP receptor, Purity: HPLC >/= 95%, Sequence (One-Letter Code): EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, MW: 4759.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg

Catalog Number: 103006-440

Supplier: Anaspec Inc

Sale

Description: 6-ROX, SE, CAS: 216699-36-4, 6-Carboxy-X-rhodamine, succinimidyl ester; 6-ROX, NHS ester, Purity: greater than or equal to 90% by HPLC, purified single isomer, for labeling peptides/proteins, sequencing nucleic acids, MW: 631.67, Spectral Properties: Abs/Em = 575/602 nm, Size: 5 mg

Catalog Number: 103010-824

Supplier: Anaspec Inc

Sale

Description: PCC (88 - 104), Purity: By HPLC >/= 95%, MW: 1890.2, Sequence: (One-Letter Code): KAERADLIAYLKQATAK17-mer peptide fragment of pigeon cytochrome c that stimulates proliferative T cell responses, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-928

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 555 C2 maleimide, thiol-reactive fluorescent labeling dye that generates the protein conjugates, slightly red-shifted, MW: 1062.3, Spectral Properties: Abs/Em = 552/569 nm, Solvent System: Water or DMF, Form: Solid, Storage -20 deg C, Size: 1 mg

Catalog Number: 103010-940

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)27]-Histone H3 (21-43)-GGK(Biotin), H3K27(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2959.5, Sequence: ATKAAR-K(Ac)-SAPATGGVKKPHRYRPGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-492

Supplier: Anaspec Inc

Sale

Description: Neurotensin, Purity: HPLC >/= 95%, Molecular Weight: 1673, Sequence: Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH, Appearance: Powder, Storage: -20 deg C, Size: 25 mg

Catalog Number: 102996-492

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me3), biotin-labeled, Sequence: ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin), Purity: By HPLC >/= 95%, residues 21 to 44 tri-methylated at Lys-27, Molecular Weight: 2959.5, Size: 1 mg

Catalog Number: 103008-010

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Homogeneous AMC Caspase-3/7 Assay Kit, Components: Caspase-3/7 substrate 270 ul, AMC 10 mM DMSO solution, 20 ul, Ac-DEVD-CHO 15 ul, Assay Buffer 30 mL, DTT 1 M, 1 mL, 10X Lysis Buffer 20 mL, with Enhanced Value, storage: -20 deg C

Catalog Number: 103010-138

Supplier: Anaspec Inc

Sale

Description: Apamin, Purity: By HPLC >/= 95%, MW: 2027.4, Sequence: (One-Letter Code): CNCKAPETALCARRCQQH-NH2 (Disulfide bridge: 1-11, 3-15) An 18-amino acid peptide from bee venom, a selective blocker of calcium activated potassium channels, Physical State: White Powder, Size: 0.5 mg

Catalog Number: 103005-972

Supplier: Anaspec Inc

Sale

Description: Pancreatic Polypeptide, human, Purity: HPLC >/= to 95%, Molecular Weight: 4181.8, Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2, is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-310

Supplier: Anaspec Inc

Sale