You Searched For: honeywell+deblocking

Description: D - Luciferin, free acid, UltraPure Grade, Luminescent substrate for firefly luciferase, MW: 280.32, Spectral Properties: Abs/Em = 328/532 nm, Solvent System: Water, CAS: 103404-75-7, Molecular Formula: C11H8N2O3S2, Physical State: Solid, Storage -20 deg C, Size: 25 mg

Catalog Number: 103011-092

Supplier: Anaspec Inc

Sale

Description: TfR Targeting Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1490.8, Sequence: THRPPMWSPVWP, 12-mer peptide sequence is a transferrin receptor (TfR) targeting peptide (transportation of small molecules across the bl), Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-428

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 ECEs Activity Assay Kit, Fluorimetric, Contains: 5-FAM /QXL*520 ECEs substrate 0.5 mM, 5-FAM fluorescence reference standard, Human recombinant ECE-1, 2X Assay Buffer 20 mL, Inhibitor 200 uM, Storage: -20 degree C, Size: 100 Assay(96-well plate)

Catalog Number: 103008-980

Supplier: Anaspec Inc

Sale

Description: HCAM-2

Catalog Number: 103007-164

Supplier: Anaspec Inc

Sale

Description: Influenza A NP (366-374) Strain A/NT/60/68

Catalog Number: 103003-276

Supplier: Anaspec Inc

Sale

Description: Human LC-beta-Amyloid (1-42), Biotin, AnaSpec

Catalog Number: 102999-818

Supplier: Anaspec Inc

Sale

Description: 6-TET, acid

Catalog Number: 103010-796

Supplier: Anaspec Inc

Sale

Description: Steroid Receptor Co-Factor Peptide

Catalog Number: 103005-894

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)9/14]-Histone H3 (1-21)-GGK,Biotin

Catalog Number: 103007-992

Supplier: Anaspec Inc

Sale

Description: TMR Biocytin [[5-(and-6)-Tetramethylrhodamine biocytin]], Molecular Weight: 869.1, Appearance: solid, Solvent System: DMSO or DMF, Orange fluorescent biotin used for studying avidin binding, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-308

Supplier: Anaspec Inc

Sale

Description: Recombinant Human Tau (Tau-441) Protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, GSK-3B kinase assay, 45.8 kDa, Application: In vitro phosphorylation, Western Immunoblotting and ELISA standard, Storage: 2-4 degree C, Size: 50ug

Catalog Number: 103001-650

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)9]-Histone H3 (1-20), H3K9(Ac), Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQL, Purity: By HPLC >/= 95%, Histone H3 acetylated at lysine 9, play an important role in chromatin-directed gene transcription, Molecular Weight: 2225.6, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-654

Supplier: Anaspec Inc

Sale

Description: SensoLyte* AMC DPPIV Assay Kit *Fluorimetric*, Components: DPPIV Substrate 55 uL, AMC 5 mM, 10 uL, DPPIV, porcine kidney 0.1 mg/mL, 15 uL, Assay Buffer 25 mL, DPPIV Inhibitor 10mM, 15 uL, Optimized Performance, Enhanced Value, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-602

Supplier: Anaspec Inc

Sale

Description: VEGFR2/KDR Antagonist, Purity: HPLC >/- 95%, Molecular Weight: 840, Sequence: H-Ala-Thr-Trp-Leu-Pro-Pro-Arg-OH, Appearance: Powder, This peptide is a specific VEGFR2/KDR heptapeptide antagonist, it binds VEGFR2 (KDR/flk), Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-280

Supplier: Anaspec Inc

Sale

Description: Calcitonin, salmon, disulfide bridge between Cys1 and Cys7, Purity: % Peak Area By HPLC >/=95%, Molecular Weight: 3431.9, Sequence (One-Letter Code): CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7),Physical State Powder, Storage -20 deg C, Size: 5mg

Catalog Number: 102998-454

Supplier: Anaspec Inc

Sale

Description: Epstein - Barr Virus (EBV) Control Peptide Pool, have been used in the stimulation of IFNgamma release from CD8+ T cells in individuals with defined HLA types, Storage: -20 deg C, Size: 3.75 mg

Catalog Number: 103007-300

Supplier: Anaspec Inc

Sale