You Searched For: Hytest Ltd

Description: MBP, MAPK Substrate, Biotinylated, Phosphorylated, Purity: By HPLC >/= 95%, MW: 1273.4, Sequence: Biotin-APR-pT-PGGRRN-terminally biotinylated peptide, with a phosphorylated Thr97, Physical State: White Powder, Size: 1 mg

Catalog Number: 103005-318

Supplier: Anaspec Inc

Sale

Description: 5-FAM-LC-LL-37, Sequence: 5-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4964.9, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-676

Supplier: Anaspec Inc

Sale

Description: Histone H3 (21-44), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2505.9, Sequence: ATKAARKSAPATGGVKKPHRYRPG, derived from Histone H3 21-44 amino acids, used as a substrate for protein arginine methyltransferases, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-180

Supplier: Anaspec Inc

Sale

Description: Histatin - 5, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): DSHAKRHHGYKRKFHEKHHSHRGY, Molecular Weight: 3036.3, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-240

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled, Sequence: ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, residues 1 to 21 tri-methylated at Lys-9, Molecular Weight: 2765.2, Size: 1 mg

Catalog Number: 103007-982

Supplier: Anaspec Inc

Sale

Description: Protegrine-1 (PG-1), amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2155.7, Sequence: RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge: 6-15 and 8-13), Protegrin-1 (PG-1) with a modified C-terminal amide, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-472

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)9]-Histone H3 (1-21), H3K9(Me1), Purity: HPLC >/= 95%, MW: 2269.1, Sequence: [ARTKQTAR-K(Me1)-STGGKAPRKQLA], monomethylated lysine at position 9 of the 1-21 amino acid histone H3 peptide. Store: -20 deg C, Size: 1mg

Catalog Number: 103009-504

Supplier: Anaspec Inc

Sale

Description: WP9QY, TNF-alpha Antagonist, Sequence: YCWSQYLCY (Disulfide bridge: 2-8), Purity: By HPLC >/= 95%, cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I, Molecular Weight: 1226.4, Size: 1 mg

Catalog Number: 103007-426

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)4]-Histone H3 (1-10), H3K4(Me1), Sequence: ART-K(Me1)-QTARKS, Purity: By HPLC greater than or equal to 95%, peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-4, Molecular Weight: 1160.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-016

Supplier: Anaspec Inc

Sale

Description: Protein A-HiLyte* Fluor 555 Conjugate, Purity: >95% SDS-PAGE, Fluorescence: Orange Fluorescence, Excitation/Emission wavelength= 553 nm/568 nm, Applications: to detect primary antibodies in IHC from many species rabbit, human, size: 1 mg

Catalog Number: 103010-694

Supplier: Anaspec Inc

Sale

Description: Pannexin - 1 (Panx1), Mimetic Blocking Peptide, Sequence: WRQAAFVDSY, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1242.4, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-080

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Ac), Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, Histone H3 amino acid residues 1 to 21 acetylated at Lys-9, Molecular Weight: 2765.3, Size: 1 mg

Catalog Number: 103007-986

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 16) - Lys(Biotin - LC) - NH2, Human, Sequence: DAEFRHDSGYEVHHQK - K(Biotin - LC) - NH2, Purity: HPLC >/= 95%, modified b-Amyloid peptide, residues 1 to 17, Molecular Weight: 2421.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-206

Supplier: Anaspec Inc

Sale

Description: Cys(Npys)-TAT (47-57), FAM-labeled, cell penetrating and carrier peptide applicable in conjugation studies, Purity: HPLC >/= 95%, Sequence (One-Letter Code): C(Npys)YGRKKRRQRRR-K(FAM)-NH2, MW: 2302.7, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-424

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-39), Purity: HPLC >/= 95%, Molecular Weight: 4230.7, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV, Appearance: Lyophilized white powder, identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease, Size: 0.5 mg

Catalog Number: 102996-520

Supplier: Anaspec Inc

Sale

Description: Streptavidin, nonglycosylated, tetrameric protein, 55,000-dalton, with each subunit able to bind a single molecule of the vitamin biotin, purified from Streptomyces avidinii, Physical State: Lyophilized powder, Solvent System: water, Storage -20 deg C desiccated, Size: 5mg

Catalog Number: 103005-956

Supplier: Anaspec Inc

Sale