You Searched For: Hytest Ltd

Description: West Nile Virus NS3 Protease, recombinant, Concentration: 100 ug/ml, is a member of the flavivirus genus, which contains many significant human pathogens including Dengue virus, positive sense 11kb RNA genome, Storage: -80 deg C, size: 5 ug

Catalog Number: 103010-404

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti-Mouse/Rat beta-Amyloid (1-42) Quantitative ELISA Kit, Colorimetric, detect peptide in brain lysate, cerebrospinal fluid/plasma, Wells are pre-coated and blocked with proprietary solution, Storage: 2-8 degree C, Size: One 96-well strip plate

Catalog Number: 103001-640

Supplier: Anaspec Inc

Sale

Description: Recombinant human MOG (1 - 125), Source: E.Coli, Purity: Greater than 95% as determined by SDS-PAGE, Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL) assay, Storage: 2-4 degree Celcius, Size: 1000ug

Catalog Number: 102998-098

Supplier: Anaspec Inc

Sale

Description: AggreSure* beta-Amyloid (1-40), human, Peptide Purity: >90%, Molecular Weight: 4329.9, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Appearance: Lyophilized white powder, this peptide is pretreated and tested for aggregation, size: 0.25 mg

Catalog Number: 103010-638

Supplier: Anaspec Inc

Sale

Description: B8R (20-27), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 960.1, Sequence: TSYKFESV, amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-426

Supplier: Anaspec Inc

Sale

Description: C3a (70 - 77) (ASHLGLAR), octapeptide & COOH-terminal fragment, Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Ala - Ser - His - Leu - Gly - Leu - Ala - Arg - OH, Molecular Weight: 823.9, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-356

Supplier: Anaspec Inc

Sale

Description: LL-37 fragment (18-37), LL-18-37, Sequence: KRIVQRIKDFLRNLVPRTES, Purity: By HPLC greater than or equal to 95%, This is fragment 18-37 of LL-37, it exhibits enhanced antimicrobial activity, Molecular Weight: 2468.9, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-518

Supplier: Anaspec Inc

Sale

Description: Pep-1-Cysteamine, Sequence: Ac-KETWWETWWTEWSQPKKKRKV-cysteamine, Purity: By HPLC >/= 95%, used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive way, Molecular Weight: 2950.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-778

Supplier: Anaspec Inc

Sale

Description: Biotin-LC-beta-Amyloid (15-25), Human, mouse/rat, Sequence: Biotin-LC-QKLVFFAEDVG, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1591.9, Apperance: powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-546

Supplier: Anaspec Inc

Sale

Description: ?-Calcitonin Gene Related Peptide, A-CGRP, rat, Purity: HPLC >/- 95%, Molecular Weight: 3806.3, Sequence: SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2, Appearance: Powder, is preferentially expressed in sensory neuron, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-360

Supplier: Anaspec Inc

Sale

Description: Histone H4 (1-23)-GSGSK, C-terminal, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3003.6, Sequence: SGRGKGGKGLGKGGAKRHRKVLRGSGS-K(Biotin), Label: Biotin, consists of amino acids 1-23 of histone H4, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-532

Supplier: Anaspec Inc

Sale

Description: Dihydroethidium, Synonym: Hydroethidine, Bind to DNA/RNA (red fluorescence) upon oxidation, MW: 315.4, Spectral Properties: Abs/Em = 518/605 nm (after oxidation), Solvent System: DMSO, form: Dark red, pink Solid, Storage: -20C desiccated and protected from light, Size: 25 mg

Catalog Number: 103011-326

Supplier: Anaspec Inc

Sale

Description: Alpha9-Gliadin (57-68), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1455.7, Sequence: QLQPFPQPQLPY, derived from amino acid 57-68 of a9-gliadin and represents an immunodominant epitope, resistant to pancreatic proteolysis, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-718

Supplier: Anaspec Inc

Sale

Description: Calcitonin Gene Related Peptide, CGRP, human, Purity: HPLC >/= to 95%, Molecular Weight: 3789.4, Sequence: ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2, Appearance: Lyophilized white powder, is a 37-amino acid neuropeptide, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-084

Supplier: Anaspec Inc

Sale

Description: Kisspeptin-10 (Kp-10), Metastin (110-119), mouse, rat, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1318.5, Sequence: YNWNSFGLRY-NH2, amidated peptide sequence is found in C-terminal 110 to 119, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-422

Supplier: Anaspec Inc

Sale

Description: 5(6)-FAM [[5-(and-6)-Carboxyfluorescein] *UltraPure Grade* *Mixed Isomers*], Purity: >90% purity HPLC, Molecular Formula: C21H12O7, Molecular Weight: 376.32, Appearance: Orange solid, Solvent System DMF or DMSO, used to prepare fluoresceinated bioconjugates, size: 10 g

Catalog Number: 103010-750

Supplier: Anaspec Inc

Sale