You Searched For: Hytest Ltd

Description: WP9QY, TNF-alpha Antagonist, Sequence: YCWSQYLCY (Disulfide bridge: 2-8), Purity: By HPLC >/= 95%, cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I, Molecular Weight: 1226.4, Size: 1 mg

Catalog Number: 103007-426

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)4]-Histone H3 (1-10), H3K4(Me1), Sequence: ART-K(Me1)-QTARKS, Purity: By HPLC greater than or equal to 95%, peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-4, Molecular Weight: 1160.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-016

Supplier: Anaspec Inc

Sale

Description: Protein A-HiLyte* Fluor 555 Conjugate, Purity: >95% SDS-PAGE, Fluorescence: Orange Fluorescence, Excitation/Emission wavelength= 553 nm/568 nm, Applications: to detect primary antibodies in IHC from many species rabbit, human, size: 1 mg

Catalog Number: 103010-694

Supplier: Anaspec Inc

Sale

Description: Pannexin - 1 (Panx1), Mimetic Blocking Peptide, Sequence: WRQAAFVDSY, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1242.4, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-080

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Ac), Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, Histone H3 amino acid residues 1 to 21 acetylated at Lys-9, Molecular Weight: 2765.3, Size: 1 mg

Catalog Number: 103007-986

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 16) - Lys(Biotin - LC) - NH2, Human, Sequence: DAEFRHDSGYEVHHQK - K(Biotin - LC) - NH2, Purity: HPLC >/= 95%, modified b-Amyloid peptide, residues 1 to 17, Molecular Weight: 2421.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-206

Supplier: Anaspec Inc

Sale

Description: Cys(Npys)-TAT (47-57), FAM-labeled, cell penetrating and carrier peptide applicable in conjugation studies, Purity: HPLC >/= 95%, Sequence (One-Letter Code): C(Npys)YGRKKRRQRRR-K(FAM)-NH2, MW: 2302.7, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-424

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-39), Purity: HPLC >/= 95%, Molecular Weight: 4230.7, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV, Appearance: Lyophilized white powder, identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease, Size: 0.5 mg

Catalog Number: 102996-520

Supplier: Anaspec Inc

Sale

Description: Streptavidin, nonglycosylated, tetrameric protein, 55,000-dalton, with each subunit able to bind a single molecule of the vitamin biotin, purified from Streptomyces avidinii, Physical State: Lyophilized powder, Solvent System: water, Storage -20 deg C desiccated, Size: 5mg

Catalog Number: 103005-956

Supplier: Anaspec Inc

Sale

Description: SV-40 Large T-antigen Nuclear Localization Signal (NLS), Sequence: CGGGPKKKRKVED, Purity: By HPLC greater than or equal to 95%, derived from Large T antigen residue 47 to 55, Molecular Weight: 1401.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-760

Supplier: Anaspec Inc

Sale

Description: Atrial Natriuretic Peptide (1-28), rat, Purity: HPLC >/= to 95%, Molecular Weight: 3062.5, Sequence: SLRRSSCFGGRIDRIGAQSGLGCNSFRY, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-080

Supplier: Anaspec Inc

Sale

Description: Lactoferricin B, Lactoferrin (17-41), Sequence: FKCRRWQWRMKKLGAPSITCVRRAF (S-S BOND), Purity: By HPLC >/= 95%, This is amino acids 17 to 41 fragment of lactoferrin, known as lactoferricin B, Molecular Weight: 3123.9, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-460

Supplier: Anaspec Inc

Sale

Description: BFGF (119 - 126), Basic Fibroblast Growth Factor, human, bovine, (KRTGQYKL), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Lys - Arg - Thr - Gly - Gln - Tyr - Lys - Leu - OH, MW: 993.2, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-334

Supplier: Anaspec Inc

Sale

Description: VIP, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3325.9, Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, Appearance: Lyophilized white powder, is a neurotransmitter and a neuromodulator, broadly distributed in the peripheral and central nervous systems, Size: 1 mg

Catalog Number: 102996-316

Supplier: Anaspec Inc

Sale

Description: 37, 40 GAP26, Connexin Mimetic, Sequence: VCYDQAFPISHIR, Purity: By HPLC >/= 95%, This peptide corresponds to the GAP26 domain of the extracellular loop of the major vascular connexins, Molecular Weight: 1548.8, Apperance: powder, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-446

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 488 acid, Protein conjugate is prepared, for fluorescein derivatives as FITC, MW: 601.53, Spectral Properties: Abs/Em = 501/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Store away from oxidizing agent, Size: 10 mg

Catalog Number: 103010-872

Supplier: Anaspec Inc

Sale