You Searched For: Hytest Ltd

Description: Histone H2B (21-41), biotin-labeled, Sequence: AQKKDGKKRKRSRKESYSIYVGG-K(Biotin), Purity: By HPLC >/= 95%, Histone 2B amino acid residues 21 to 41 with a C-terminal GG linker followed by a biotinylated lysine, Molecular Weight: 3024.6, Storage: -20 C, Size: 1 mg

Catalog Number: 103008-048

Supplier: Anaspec Inc

Sale

Description: RYR2 (2460-2495), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4103.9, Sequence: GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP, amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2), controls calcium release, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-442

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-37), Human, Purity: Greater than or equal to 95% (% Peak Area By HPLC), Molecular weight: 4074.6, Sequence: (One-Letter Code) AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG, Storage: At -20 degree C, Size: 1mg

Catalog Number: 103003-042

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)27]-Histone H3 (23-34), H3K27(Me2), Sequence: KAAR-K(Me2)-SAPATGG, Purity: By HPLC >/= 95%, peptide is Histone H3 amino acid residues 23 to 34 di-methylated at Lys-27, Molecular Weight: 1142.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-032

Supplier: Anaspec Inc

Sale

Description: [Pyr1] - Apelin - 13, Purity: By HPLC >/= 95%, MW: 1533.8, Sequence: (One-Letter Code): Pyr-RPRLSHKGPMPF-OH [125I]-(Pyr1)Apelin-13 binds with high affinity and selectivity to human cardiac tissue, Appearance: Lyophilized white powder, Size: 1 mg

Catalog Number: 103005-982

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (22 - 35), Human, mouse/rat, Sequence: EDVGSNKGAIIGLM, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1403.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102999-350

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Generic MMP Assay Kit Colorimetric, Components: MMP colorimetric substrate 10 mM, 100 uL, Reference standard 10 mM, 10 uL, Assay Buffer 20 mL, MMP inhibitor 2 mM, 10 uL, Trypsin 1 mg/mL, 100 uL,Trypsin inhibitor 10 mg/mL, 100 uL, Stop Solution 5 mL

Catalog Number: 103010-412

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 FRET SIRT1 Assay Kit *Fluorimetric*, Components: SIRT1 520 FRET substrate 1 mM, 50 ul, Deacetylated FRET 1 mM, 20 ul, SIRT1, Human Recom 0.1 mg/mL, 100 ul, Assay Buffer 20 mL, NAD+ 20 mM, 100 ul, Nicotinamide 30 m?, 0.5 mL, SIRT1 Developer 0.5 mL

Catalog Number: 103010-514

Supplier: Anaspec Inc

Sale

Description: Erythropoietin-Mimetic Peptide 17 (EMP17), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1981.3, Sequence: TYSCHFGPLTWVCKPQGG, EMP17 is the hormone involved in red blood cell production, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-150

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)382]-p53 (372-389), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2473, Sequence: Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG, Label: Biotin, derived from amino acid residues 372-389 of p53 tumor suppressor protein, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-518

Supplier: Anaspec Inc

Sale

Description: SensoLyte* ADHP Peroxidase Assay Kit, Components: ADHP 10 mM, 250 ul, H2O2 1 vial, Assay buffer 60 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-128

Supplier: Anaspec Inc

Sale

Description: Tyrosine Kinase Peptide 3 [RRLIEDAE-pY-AARG], Phosphorylated, Purity: HPLC >/= to 95%, Molecular Weight: 1599.7, Sequence: H-Arg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-pTyr-Ala-Ala-Arg-Gly-OH, Appearance: powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-570

Supplier: Anaspec Inc

Sale

Description: Insulin B (9-23) insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): SHLVEALYLVCGERG, Molecular Weight: 1645.9, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-812

Supplier: Anaspec Inc

Sale

Description: EA (52-68), class II MHC EA chain (EA) (52-68) peptide (AbBEp). It occupies about 10% of natural Iab, Purity: HPLC >/=95%, Sequence (One-Letter Code): ASFEAQGALANIAVDKA, Molecular weight: 1675.9, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-882

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Thrombin Activity Assay Kit *Fluorimetric*, Components: Thrombin substrate 2 mM, 50 ul, 5-FAM 2 mM, 10 ul, 2X Assay buffer 20 mL, Purified human thrombin enzyme 0.1 mg/mL, 40 ul,Thrombin inhibitor 60 u
M, 10 ul, Stop solution 5 mL

Catalog Number: 103010-466

Supplier: Anaspec Inc

Sale

Description: Bacterial Sortase Substrate I, FRET, Sequence: DABCYL - LPETG - EDANS, Purity: By HPLC greater than or equal to 95%, sortase substrate, C-terminal sorting signal, Molecular Weight: 1015.2, Apperance: Lyophilized red powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-254

Supplier: Anaspec Inc

Sale