You Searched For: Hytest Ltd

Description: ClearPoint* beta-Amyloid (1-40), 13C, 15N - labeled at Arg & Lys, Human, Sequence: DAEF-R*-HDSGYEVHHQ-K*-LVFFAEDVGSN-K*-GAIIGLMVGGVV, Purity: By HPLC >/= 95%, All Arginine and Lysines have universally labeled, Molecular Weight: 4355.9, Size: 50 ug

Catalog Number: 103007-698

Supplier: Anaspec Inc

Sale

Description: Autocamtide-3 Derived Inhibitory Peptide(AC3-I); CaMKII Inhibitor, myristoylated, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1689.1, Sequence: Myr-KKALHRQEAVDAL, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-590

Supplier: Anaspec Inc

Sale

Description: [Cys(HiLyte* Fluor 647 C2 maleimide)]-Exendin-4, Sequence: C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Purity: By HPLC >/= 95%, HiLyte Fluor 647 labeled Extendin-4, Molecular Weight: 5486.3, Size: 50 ug

Catalog Number: 103007-522

Supplier: Anaspec Inc

Sale

Description: SMCC Activated B - PE (B - Phycoerythrin), a fluorescent protein from phycobiliprotein family, is isolated from cyanobacteria and eukaryotic algae, SMCC activated B-PE is chemically modified with SMCC, reacts with the primary amine on B-PE, Storage: 4 deg C, Size: 1 mg

Catalog Number: 103010-440

Supplier: Anaspec Inc

Sale

Description: NY-ESO-1 (87-111), Sequence: LLEFYLAMPFATPMEAELARRSLAQ, Purity: By HPLC greater than or equal to 95%,This is amino acids 81 to 111 fragment of the NY-ESO-1, expressed by many tumors of different histological types, Molecular Weight: 2869.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-462

Supplier: Anaspec Inc

Sale

Description: Streptavidin, Recombinant, Streptavidin is a nonglycosylated tetrameric protein that binds biotin noncovalently and with high affinity, was expressed in E. Coli, It shows one major band about 56 kDa on SDS-PAGE, Apperance: Lyophilized powder, size: 500 mg

Catalog Number: 103010-564

Supplier: Anaspec Inc

Sale

Description: SensoLyte* GST Activity Assay Kit *Fluorimetric*, Components: GST Substrate 1 vial, GST Standard 10 U/mL, 40 uL, Assay buffer 50 mL, Reduced Glutathione 20 mM, 300 uL, DMSO 100 uL, Optimized Performance, Enhanced Value, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-518

Supplier: Anaspec Inc

Sale

Description: Suc-LLVY-AMC, fluorogenic substrate, Sequence: Suc-LLVY-AMC, Purity: By HPLC >/= 95%, used as a fluorogenic substrate for 20S proteasome, calpains and other chymotrypsin-like proteases, Molecular Weight: 763.9, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103007-798

Supplier: Anaspec Inc

Sale

Description: OPA, Synonym: o - Phthaldialdehyde, UltraPure Grade, Fluorogenic indicator for primary amino group; Widely used for quantitation of peptides and proteins, Molecular Weight: 134.1, Spectral Properties: Abs/Em = 334/456 nm, Solvent System: DMSO or DMF, CAS: 643-79-8, MF: C8H6O2, Size: 1 g

Catalog Number: 103011-116

Supplier: Anaspec Inc

Sale

Description: Histone H3 (21-44)-GK(Biotin), amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2932.5, Sequence: ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2, Label: Biotin, peptide is Histone H3 (21-44) with an C-terminal glycine, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-388

Supplier: Anaspec Inc

Sale

Description: DABCYL Plus* acid, acceptors for developing FRET-based nucleic acid probes and protease substrates, high hydrophobicity, poor water solubility, Purity: 95%, MW: 377.42, Spectral: Abs/Em = 437/none nm, Solvent System: Water or DMSO, Storage: -20 deg C, Size: 100 mg

Catalog Number: 103011-052

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid Peptide (1-42), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4418, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized off-white powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-720

Supplier: Anaspec Inc

Sale

Description: AnaTag* HiLyte* Fluor 555 Microscale Protein Labeling Kit *Ultra Convenient* Component: HiLyte Fluor* 555 SE 3 vials, Reaction buffer 0.5 mL, Spin column, DMSO 150 uL, Elution buffer 20 mL, Wash tube 3 tubes, Collect tube 3 tubes

Catalog Number: 103010-352

Supplier: Anaspec Inc

Sale

Description: Vitronectin (367-378), Purity: HPLC >/= 95%, MW: 1668, Sequence: [GKKQRFRHRNRKG] This heparin-binding peptide is derived from vitronectin (367-378). Monomer form in the blood and oligomer form in the extraceullular matrix. Biotin - labeled, Store: -20 deg C, Size: 5mg

Catalog Number: 103009-404

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)14]-Histone H3 (1-19), H3K14(Ac), Sequence: ARTKQTARKSTGG-K(Ac)-APRKQ, Purity: By HPLC greater than or equal to 95%, peptide is Histone H3 acetylated at lysine 14, Molecular Weight: 2112.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-658

Supplier: Anaspec Inc

Sale

Description: HIV Substrate, Purity: HPLC >/- 95%, Molecular Weight: 2008.1, Sequence: QXL* 520-GABA-SQNYPIVQ-K(HiLyte* Fluor 488)-NH2, label: HiLyte* Fluor 488, The peptide sequence is derived from the native p17/p24 cleavage site on HIV precursor polyprotein, Size: 0.1 mg

Catalog Number: 103003-284

Supplier: Anaspec Inc

Sale