You Searched For: Hytest Ltd

Description: Prosaptide TX14(A), Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1579.7, Sequence: TaLIDNNATEEILY
, 14-mer prosaptide sequence is derived from active neurotrophic region in amino-terminal portion of the saposin C domain, Storage: At -20 degree C, Size: 5mg

Catalog Number: 103003-030

Supplier: Anaspec Inc

Sale

Description: Epstein - Barr Virus (EBV) Control Peptide Pool, have been used in the stimulation of IFNgamma release from CD8+ T cells in individuals with defined HLA types, Storage: -20 deg C, Size: 3.75 mg

Catalog Number: 103007-300

Supplier: Anaspec Inc

Sale

Description: PA (224-233), Influenza murine H-2 Db- and Kb-restricted immunodominant CTL epitope of influenza PR8 virus, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): SSLENFRAYV, Molecular Weight: 1185.3, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-884

Supplier: Anaspec Inc

Sale

Description: H-Ala-Pro-AFC, Purity: HPLC >/= to 95%, Molecular Weight: 397.2, Sequence: AP-AFC, Appearance: powder, This is a fluorescent peptide, Storage: -20 deg C, Size: 10 mg

Catalog Number: 102996-438

Supplier: Anaspec Inc

Sale

Description: Biotin-LC-LL-37, Sequence: Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, Purity: By HPLC >/= 95%, Molecular Weight: 4832.8, Apperance: Lyophilized white powder, Peptide Reconstitution: Biotin - LC - LL - 37 is freely soluble in water, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-674

Supplier: Anaspec Inc

Sale

Description: Human MMP -3, Concentration: 10 ug/mL, Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components, It can be used as a positive control, Storage: -80 deg C, size: 100 uL

Catalog Number: 103010-280

Supplier: Anaspec Inc

Sale

Description: Pancreatic Polypeptide, human, Purity: HPLC >/= to 95%, Molecular Weight: 4181.8, Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2, is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-312

Supplier: Anaspec Inc

Sale

Description: Cys-TAT (47-57), PKCE inhibitor peptide, for examining cell penetrating abilities, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): CYGRKKRRQRRR-NH2, Molecular Weight: 1662, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-422

Supplier: Anaspec Inc

Sale

Description: Human MMP-9 (Recombinant, Catalytic Domain), Matrix metalloproteinases, Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE, corresponding to the catalytic domain (aa 112-445), 40 kDa, Storage: -80 degree C, Size: 1ug

Catalog Number: 103001-688

Supplier: Anaspec Inc

Sale

Description: FITC-LC-TAT (47 - 57), Sequence (One-Letter Code): FITC-LC-YGRKKRRQRRR-NH2, Peptide Purity: >95%, Appearance: Lyophilized yellow powder, Molecular Weight: 2061.4, peptide contains a long chain (LC) to prevent FITC from degradation. Abs/Em = 493/522 nm, Size: 1 mg

Catalog Number: 103000-578

Supplier: Anaspec Inc

Sale

Description: [Asn23]-beta-Amyloid (1-40), Iowa Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV, Purity: HPLC >/= 95%, naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor, Molecular Weight: 4328.9, Size: 0.5 mg

Catalog Number: 103007-210

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Thioflavin T B-Amyloid (1-42) Aggregation Kit, Components: Assay Buffer 25 ml, Beta-Amyloid (1-42) (AB42), human 0.5 mg (2 x 0.25 mg), Thioflavin T 20 mM, 100 ul, Morin 10 mM, 25 ul, Phenol Red 10 mM, 25 ul, storage: -20 deg C

Catalog Number: 103010-636

Supplier: Anaspec Inc

Sale

Description: OVA (257 - 264), scrambled, FILKSINE, Purity: HPLC >/=95%, class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC molecule, H-2Kb, Storage: -20 deg C, MW 963.2, Sequence: Phe - Ile - Leu - Lys - Ser - Ile - Asn - Glu, Size: 1mg

Catalog Number: 102995-924

Supplier: Anaspec Inc

Sale

Description: Lys(Me2)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me2), biotin-labeled, Purity: HPLC >/=95%, Sequence (One-Letter Code): ART-K(Me2)-QTARKSTGGKAPRKQLA-GGK(Biotin), Molecular weight: 2751.2, Storage: -20 degree C, Size: 0.25 mg

Catalog Number: 103006-532

Supplier: Anaspec Inc

Sale

Description: [Arg(Me2a)3]-Histone H4 (1-23)-GGK, Purity: HPLC >/= 95%, MW: 2857.4, Sequence: [SG-R(Me2a)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)] asymmetrically dimethylated at Arg3 followed by a biotinylated Lys conjugated to a C-terminal GG linker. Store: -20 deg C, Size: 1mg

Catalog Number: 103009-362

Supplier: Anaspec Inc

Sale

Description: Calcein, AM *UltraPure Grade*, 5 mM solution in anhydrous DMSO, CAS no: 148504-34-1, Purity: >/= 95% HPLC, cell-permeant and non-fluorescent compound that is widely used for determining cell viability, Molecular Weight: 994.9, Spectral Properties: Abs/Em = 494/517 nm, Size: 200ul

Catalog Number: 103011-400

Supplier: Anaspec Inc

Sale