You Searched For: Hytest Ltd

Description: HiLyte* Fluor 488 acid, SE, amine-reactive fluorescent labeling dye, Synonym: HiLyte* Fluor 488 acid, NHS ester, Molecular Weight: 698.6, Spectral Properties: Abs/Em = 502/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103010-874

Supplier: Anaspec Inc

Sale

Description: Histone H3 (23-34), Sequence: KAARKSAPATGG, Purity: By HPLC greater than or equal to 95%, This peptide is Histone H3 amino acid residues 23 to 34, Molecular Weight: 1114.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-028

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Calpain Activity Assay Kit *Fluorimetric*, Components: 5-FAM/QXL? 520 Calpain Substrate 1 mM, 50 ul, 5-FAM 1 mM, 10 ul, Assay Buffer 20 mL, Human Calpain 0.5 mg/mL, 100 ul, Calpain Inhibitor 50 uM, 10 ul, DTT 1 M, 20 ul, storage: -20 deg C

Catalog Number: 103010-504

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-37), Human, Purity: Greater than or equal to 95% (% Peak Area By HPLC), Molecular weight: 4074.6, Sequence: (One-Letter Code) AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG, Storage: At -20 degree C, Size: 0.5mg

Catalog Number: 103003-040

Supplier: Anaspec Inc

Sale

Description: GRGDS, amide (GRGDS - NH2), Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code: H - Gly - Arg - Gly - Asp - Ser - NH2, Molecular Weight: 489.5, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg

Catalog Number: 103006-346

Supplier: Anaspec Inc

Sale

Description: DABCYL acid, SE, Synonym: 4-((4-(dimethylamino)phenyl)azo)benzoic acid, succinimidyl ester; DABCYL acid, NHS ester, acceptors for developing FRET-based nucleic acid probes, Purity: 95%, MW: 366.37, Spectral: Abs/Em = 453/none nm, Solvent System: DMF or DMSO, Size: 100 mg

Catalog Number: 103011-048

Supplier: Anaspec Inc

Sale

Description: Fibrinogen Binding Inhibitor Peptide, Purity: HPLC >/- 95%, Molecular Weight: 1190.3, Sequence: H-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val-OH, is important for platelet aggregation, The sequence is derived from the carboxy terminus, Size: 1 mg

Catalog Number: 103003-350

Supplier: Anaspec Inc

Sale

Description: Rhodopsin Epitope Tag, Sequence: TETSQVAPA, Purity: HPLC greater than or equal to 95%, peptide representing C terminus of bovine rhodopsin widely used as an epitope tag, recognized by anti-rhodopsin antibodies, Molecular Weight: 903, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103007-234

Supplier: Anaspec Inc

Sale

Description: CKS-17 (dimer), MN10021, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4088.8, Sequence: LQNRRGLDLLFLKEGGLC (dimer), dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (cysteine-disulfide linkage), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-252

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 440 Cathepsin B Assay Kit *Fluorimetric*, Components: Cathepsin B substrate 1 mM, 50 ul, AMC 1 mM, 10 uL, Cathepsin B enzyme 5 uL, Assay Buffer 20 mL, Cathepsin B inhibitor Ac-LVK-CHO 100 uM, 10 uL, DTT 1 M, 100 uL, storage: -20 deg C

Catalog Number: 103010-534

Supplier: Anaspec Inc

Sale

Description: PKTPKKAKKL, Purity: Greater than or equal to 95%(HPLC), Molecular weight: 1138.5, Sequence: H-Pro-Lys-Thr-Pro-Lys-Lys-Ala-Lys-Lys-Leu-OH (3-letter code), derived from histone H1 peptide sequence, It is an effective CDK5 substrate (Km = 40 uM), Storage: At -20 Degree C, Size: 1mg

Catalog Number: 103002-946

Supplier: Anaspec Inc

Sale

Description: Recombinant Human Tau (Tau-441) Protein, GST tagged at the N-terminal, Microtubule associated protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, 71.8 kDa, Application: In vitro phosphorylation, Storage: 2-4 degree C, Size: 50ug

Catalog Number: 103001-726

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)5/8/12/16]-Histone H4 (1-21)-GGK(Biotin), H4K5/8/12/16(Ac), Purity: Greater than or equal to 95%(HPLC), Molecular weight: 2728.2, Sequence: SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-528

Supplier: Anaspec Inc

Sale

Description: 5(6)-FAM [[5-(and-6)-Carboxyfluorescein] *UltraPure Grade* *Mixed Isomers*], Purity: >90% purity HPLC, Molecular Formula: C21H12O7, Molecular Weight: 376.32, Appearance: Orange solid, Solvent System DMF or DMSO, used to prepare fluoresceinated bioconjugates, size: 10 g

Catalog Number: 103010-750

Supplier: Anaspec Inc

Sale

Description: O-linked GlcNAc transferase (OGT) Substrate, Sequence: KKKYPGGSTPVSSANMM, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1783.1, Apperance: powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-532

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)40]-Ac-a-Tubulin (29-50)-WGK(Biotin); TubK40(Ac)-WGK, Purity: HPLC >/= 95%, MW: 2918.2, Sequence: [Ac-GIQPDGQMPSD-K(ac)-TIGGGDDSFNWG-K(biotin)], with a C-terminal WG linker followed by a biotinylated lysine. Biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-516

Supplier: Anaspec Inc

Sale