Description: SensoLyte* Rh110 Matriptase Activity Assay Kit, Fluorimetric, Contains: Rh110 Matriptase substrate, Rh110 fluorescence reference standard, Matriptase, human recombinant, Assay Buffer, Leupeptin, Storage: -20 degree C, Size: 100 Assays (96-well plate)

Catalog Number: 103008-976

Supplier: Anaspec Inc

Sale

Description: Fura-2, AM, Excitation-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration, Molecular Weight: 1001.9, Spectral Properties: Abs/Em = 363/512 nm, Solvent System: DMSO, CAS No: 108964-32-5, Molecular formula: C44H47N3O24, Storage -20 deg C, Size: 1 mg

Catalog Number: 103011-172

Supplier: Anaspec Inc

Sale

Description: TAT (47 - 57), Purity: % Peak Area By HPLC >/= 95%, Molecular Weight: 1559.9, Sequence: (One-Letter Code): YGRKKRRQRRR the most characterized fragment of the HIV transactivator protein (TAT), Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103005-826

Supplier: Anaspec Inc

Sale

Description: PACAP (6-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4024.8, Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-258

Supplier: Anaspec Inc

Sale

Description: Melan-A/MART-1 (27-35), Purity: HPLC >/- 95%, Molecular Weight: 814.6, Sequence: H-Ala-Ala-Gly-Ile-Gly-Ile-Leu-Thr-Val-OH, Appearance: Powder, Melan-A is a melanocyte differentiation antigen recognized by cytotoxic T lymphocytes, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-258

Supplier: Anaspec Inc

Sale

Description: Biotin-X NTA [[Biotin-X nitrilotriacetic acid, tripotassium salt]], Molecular Weight: 716, Appearance: solid, Solvent System: water, Excellent reagent for detecting polyhistidine-containing biomolecules, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-304

Supplier: Anaspec Inc

Sale

Description: QXL* 490 acid, Molecular Weight: 377.42, Solvent System DMSO or DMF, dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of EDANS and AMCA, Storage -20 deg C, size: 5 mg

Catalog Number: 103010-224

Supplier: Anaspec Inc

Sale

Description: Renin Substrate, human, Purity: HPLC >/= 95%, Molecular Weight: 1760, Sequence: H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn-OH, Appearance: Powder, it acts on this sequence serving as its substrate yielding Angiotensin I and VIHN, Storage: -20 deg C, Size: 1mg

Catalog Number: 102996-064

Supplier: Anaspec Inc

Sale

Description: Big Endothelin-1 (1-38), human, Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11), Purity: By HPLC >/= 95%, Big Endothelin-1 (1-38) is precursor of endothelin 1, Molecular Weight: 4283, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-562

Supplier: Anaspec Inc

Sale

Description: MOG (35-55), human, Sequence: MEVGWYRPPFSRVVHLYRNGK, Purity: >/= 95%, This is amino acids 92 to 106 fragment of the myelin oligodendrocyte glycoprotein, can be used to induce experimental autoimmune encephalomyelitis, Molecular Weight: 2592, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-806

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 43), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4615.2, Solid AB (1-43) fibril is the most fibrillogenic of all the AB peptides, Apperance: Powder, Size: 1 mg

Catalog Number: 102999-854

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (25-35), Human, mouse/rat, Purity: HPLC >/- 95%, Molecular Weight: 1060.3, Sequence: H-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-OH, Appearance: Lyophilized white powder, AB (25-35) is the main factor responsible for AB neurotoxic effects, Size: 1 mg

Catalog Number: 103003-706

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Green Pin1 Assay Kit, Fluorimetric, Contains: Pin1 Green Substrate, Pin1, Human Recombinant, Pin1 Developer, 100X, Assay Buffer, Pin1 Inhibitor, optimized to detect Pin-1 activity, Storage: -20 degree C, Size: 100 Assays (96-well plate)

Catalog Number: 103008-974

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate VI, Purity: HPLC >/- 95%, Molecular Weight: 1822.9, Sequence: QXL* 520-Pro-Leu-Gly-Met-Trp-Ser-Arg-Lys(5-FAM)-NH2, A sensitive substrate for assaying MMP-2 and 13 activities, Abs/Em = 494/521 nm, Storage: -20 deg C, size: 0.1 mg

Catalog Number: 103003-248

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 532 acid, SE, amine-reactive fluorescent labeling dye, with fluorescence excitation and emission maxima of Approx 545 nm and Approx 565 nm, MW: 875.36, Spectral Properties: Abs/Em = 545/565 nm, Solvent System: DMF or DMSO, Storage -20C, Size: 1 mg

Catalog Number: 103011-410

Supplier: Anaspec Inc

Sale

Description: Glucagon - Like Peptide 1, GLP - 1 amide, human, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2, Peptide Purity: >95%, Molecular Weight: 4111.5, Appearance: Lyophilized white powder, Storage: –20 deg C or lower, Size: 0.5mg

Catalog Number: 102999-326

Supplier: Anaspec Inc

Sale