Print…

You Searched For: Hytest Ltd


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-102996-262

PACAP (1-38) 0.5 mg

Description: PACAP (1-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4534.3, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, Appearance: Lyophilized white powder, isolated from bovine hypothalmus, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-262
Supplier: Anaspec Inc
Image Unavailable-102996-500

Human;Rat;Mouse;Pig;Chicken;Frog Somatostatin 14 Peptide

Description: Human;Rat;Mouse;Pig;Chicken;Frog Somatostatin 14 Peptide
Catalog Number: 102996-500
Supplier: Anaspec Inc
Image Unavailable-102996-430

Dipeptidylaminopeptidase IV Substrate, AMC (7-amino-4-methylcoumarin)

Description: Dipeptidylaminopeptidase IV Substrate, AMC (7-amino-4-methylcoumarin)
Catalog Number: 102996-430
Supplier: Anaspec Inc
Image Unavailable-103006-896

Lymphocytic Choreomeningitis Virus (LCMV) Glycoprotein 33 (33–41)

Description: Lymphocytic Choreomeningitis Virus (LCMV) Glycoprotein 33 (33–41)
Catalog Number: 103006-896
Supplier: Anaspec Inc
Image Unavailable-102996-540

Human;Rat Endothelin 3

Description: Human;Rat Endothelin 3
Catalog Number: 102996-540
Supplier: Anaspec Inc
Image Unavailable-103008-550

Lymphocytic Choreomeningitis Virus (LCMV) Glycoprotein 61-80

Description: Lymphocytic Choreomeningitis Virus (LCMV) Glycoprotein 61-80
Catalog Number: 103008-550
Supplier: Anaspec Inc
Image Unavailable-103010-154

SensoLyte* 490 MMP-3 Assay Kit

Description: SensoLyte* 490 MMP-3 Assay Kit *Fluorimetric*, Components: MMP-3 substrate 270 ul, EDANS 1 mM, 10 ul, APMA 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, storage: -20 deg C
Catalog Number: 103010-154
Supplier: Anaspec Inc
Image Unavailable-103008-644

[Lys(Me3)12]-Histone H4(1-21)-GGK,Biotin

Description: [Lys(Me3)12]-Histone H4(1-21)-GGK,Biotin
Catalog Number: 103008-644
Supplier: Anaspec Inc
Image Unavailable-103005-944

520 MMP FRET Substrate XV, QXL™ 520-FAM, AnaSpec

Description: 520 MMP FRET Substrate XV, QXL™ 520-FAM, AnaSpec
Catalog Number: 103005-944
Supplier: Anaspec Inc
Image Unavailable-103008-338

[Lys(Me2)20]-Histone H4 (1-23)-GGK,Biotin

Description: [Lys(Me2)20]-Histone H4 (1-23)-GGK,Biotin
Catalog Number: 103008-338
Supplier: Anaspec Inc
Image Unavailable-103003-268

GSK3 Substrate, a, b Subunit

Description: GSK3 Substrate, a, b Subunit
Catalog Number: 103003-268
Supplier: Anaspec Inc
Image Unavailable-103005-968

Buthus tamulus Iberiotoxin (IbTX)

Description: Buthus tamulus Iberiotoxin (IbTX)
Catalog Number: 103005-968
Supplier: Anaspec Inc
Image Unavailable-103006-682

PDKtide

Description: PDKtide
Catalog Number: 103006-682
Supplier: Anaspec Inc
Image Unavailable-102996-516

[Arg8]-Vasopressin (AVP) Peptide

Description: [Arg8]-Vasopressin (AVP) Peptide
Catalog Number: 102996-516
Supplier: Anaspec Inc
Image Unavailable-103010-614

SensoLyte* 520 Deubiquitination Assay Kit

Description: SensoLyte* 520 Deubiquitination Assay Kit *Fluorimetric*, Components: 520 DUB fluorogenic substrate 2 mM, 50 ul, Fluorescence standard 2 mM, 10 ul, Deubiquitin protease 0.5 mg/mL, 20 ul, 2X Assay Buffer 25 mL, DTT 1 M, 100 ul, UCH-L3 Inhibitor 4 mM, 10 ul
Catalog Number: 103010-614
Supplier: Anaspec Inc
Image Unavailable-102999-790

Human Beta-Amyloid (1-40)

Description: Human Beta-Amyloid (1-40)
Catalog Number: 102999-790
Supplier: Anaspec Inc
177 - 192 of 2,094