You Searched For: Hytest Ltd

Description: Beta-Amyloid (1-40), Human, Purity: HPLC >/- 95%, Molecular Weight: 5333.2, Sequence: HiLyte* Fluor 647-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: HiLyte* Fluor 647, Appearance: Powder, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103003-182

Supplier: Anaspec Inc

Sale

Description: TMRM, Synonym: Tetramethylrhodamine, methyl ester, perchlorate, Used for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location, Molecular Weight: 500.9, Spectral Properties: Abs/Em = 549/573 nm, Solvent System DMSO, Storage: -20 deg C, Size: 25mg

Catalog Number: 103011-370

Supplier: Anaspec Inc

Sale

Description: STAL-2, Purity: HPLC >/- 95%, Molecular Weight: 747.9, Sequence: H-Ser-Phe-Leu-Leu-Arg-Asn-NH2, Appearance: Powder, This hexapeptide, referred to as STAL-2 or TRAP, is a protease-activated receptor (PAR-1) agonist peptide, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-344

Supplier: Anaspec Inc

Sale

Description: PACAP (1-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4534.3, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, Appearance: Lyophilized white powder, isolated from bovine hypothalmus, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-264

Supplier: Anaspec Inc

Sale

Description: Biotin - LC - Angiotensin II, Purity: By HPLC >/= 95%, MW: 1385.7, Sequence: (One-Letter Code): Biotin-LC-DRVYIHPFbiotinylated on the N-terminus via an LC (long chain, also known as 6-Aminohexanoyl, 6-Aminocaproyl or Ahx), Size: 5 mg

Catalog Number: 103005-908

Supplier: Anaspec Inc

Sale

Description: Alpha-Gliadin (31-43), Purity: Greater than or equal to 95% (HPLC), Formula: C71H102N18O, Molecular weight: 1527.7, Sequence: LGQQQPFPPQQPY, Appearance: Powder, derived from gliadin wheat protein residues 31-43, innate immune response, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-720

Supplier: Anaspec Inc

Sale

Description: 5-TAMRA, SE, Synonym: 5-Carboxytetramethylrhodamine, succinimidyl ester; 5-TAMRA, NHS ester, for labeling proteins, the single isomers for labeling peptides, nucleotides, Molecular Weight: 527.53, Molecular Formula: C29H25N3O7, Spectral Properties: Abs/Em = 547/574 nm, Size: 5mg

Catalog Number: 103010-848

Supplier: Anaspec Inc

Sale

Description: C - Type Natriuretic Peptide (32 - 53), human, porcine, Sequence: GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6 - 22), Purity: HPLC greater than or equal to 95%, Molecular Weight: 2197.7, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102999-796

Supplier: Anaspec Inc

Sale

Description: D - Luciferin, free acid, UltraPure Grade, Luminescent substrate for firefly luciferase, MW: 280.32, Spectral Properties: Abs/Em = 328/532 nm, Solvent System: Water, CAS: 103404-75-7, Molecular Formula: C11H8N2O3S2, Physical State: Solid, Storage -20 deg C, Size: 25 mg

Catalog Number: 103011-092

Supplier: Anaspec Inc

Sale

Description: TfR Targeting Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1490.8, Sequence: THRPPMWSPVWP, 12-mer peptide sequence is a transferrin receptor (TfR) targeting peptide (transportation of small molecules across the bl), Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-428

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 ECEs Activity Assay Kit, Fluorimetric, Contains: 5-FAM /QXL*520 ECEs substrate 0.5 mM, 5-FAM fluorescence reference standard, Human recombinant ECE-1, 2X Assay Buffer 20 mL, Inhibitor 200 uM, Storage: -20 degree C, Size: 100 Assay(96-well plate)

Catalog Number: 103008-980

Supplier: Anaspec Inc

Sale

Description: HCAM-2

Catalog Number: 103007-164

Supplier: Anaspec Inc

Sale

Description: Influenza A NP (366-374) Strain A/NT/60/68

Catalog Number: 103003-276

Supplier: Anaspec Inc

Sale

Description: Human LC-beta-Amyloid (1-42), Biotin, AnaSpec

Catalog Number: 102999-818

Supplier: Anaspec Inc

Sale

Description: 6-TET, acid

Catalog Number: 103010-796

Supplier: Anaspec Inc

Sale

Description: Steroid Receptor Co-Factor Peptide

Catalog Number: 103005-894

Supplier: Anaspec Inc

Sale