You Searched For: Hytest Ltd

Description: 520 MMP FRET Substrate IX, Purity: % Peak Area By HPLC >/= 95%, Molecular Weight: 1889.1, Sequence: (One-Letter Code): QXL* 520-RPLALWRK(5-FAM)-NH2 A sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm, Size: 0.1 mg

Catalog Number: 103005-932

Supplier: Anaspec Inc

Sale

Description: Recombinant human A-Synuclein (1-140), biotin labeled, Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE and mass spectrometry, expressed and purified from E. Coli and conjugated with biotin, Storage: -80 degree C, Size: 200ug

Catalog Number: 103001-712

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)27]-Histone H3 (23-34), H3K27(Me3), Sequence: KAAR-K(Me3)-SAPATGG, Purity: By HPLC >/= 95%, peptide is Histone H3 amino acid residues 23 to 34 tri-methylated at Lys-27, Molecular Weight: 1156.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-034

Supplier: Anaspec Inc

Sale

Description: Bovine B-Casein, monophosphopeptide, for characterization of phosphorylated peptides in liquid chromatography, Purity: HPLC >/=95%, Sequence (1-Letter Code): FQ-pS-EEQQQTEDELQDK, MW: 2062, Form: Lyophilized white powder, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-364

Supplier: Anaspec Inc

Sale

Description: Angiotensin II, human, TAMRA-labeled, Abs/Em = 541/565 nm, Purity: HPLC >/=95%, Sequence (One-Letter Code): TAMRA-DRVYIHPF, Sequence (Three-Letter Code): TAMRA-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH, MW: 1458.7, Form: Powder, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-390

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 647 amine, Purity >/=95% HPLC, Molecular Weight: 1045.34, Solvent System: water, is a carbonyl-reactive fluorescent labeling dye that generates the conjugates that are slightly red-shifted compared to those of Cy5 dyes, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103010-194

Supplier: Anaspec Inc

Sale

Description: MOG (1 - 125), Recombinant protein, Source: Rat, Purity: Greater than 95% (SDS-PAGE), Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL), quantitative kinetic assay, Application: ELISA, Size: 100ug

Catalog Number: 103004-650

Supplier: Anaspec Inc

Sale

Description: [Leu31, Pro34]-Neuropeptide Y, human, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4240.8, Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2Like neuropeptide Y and other peptides of the family, this peptide adopts a folded hairpin structure, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-554

Supplier: Anaspec Inc

Sale

Description: Gastrin-1, human, Purity: HPLC >/= 95%, Molecular Weight: 2098.2, Sequence: Pyr-GPWLEEEEEAYGWMDF-NH2, Appearance: Powder, Secretion of gastrin is induced by food intake and causes the release of gastric acid in the stomach, Storage: -20 deg C, Size: 1mg

Catalog Number: 102996-110

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 594 acid, SE, Synonym: HiLyte* Fluor 594 acid, NHS ester, an alternative to Alexa Fluor* 594 and DyLight Fluor* 594, Molecular Weight 848.94, Spectral Properties: Abs/Em = 593/616 nm, Solvent System: DMF/DMSO, Storage: -20 deg C, Form: Solid, Size: 1 mg

Catalog Number: 103010-956

Supplier: Anaspec Inc

Sale

Description: (Arg)9, biotin-labeled, Sequence: Biotin-LC-RRRRRRRRR-NH2, Purity: By HPLC >/= 95%, peptide sequence with nine arginines contains a biotin group attached to the epsilon amino group of lysine at the N-terminus, Molecular Weight: 1762.2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-820

Supplier: Anaspec Inc

Sale

Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-406

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-28), Human, Purity: HPLC >/= to 95%, Molecular Weight: 3262.5, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK, The three-dimensional solution structure of AB (1-28) reveals the folding of the peptide, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-486

Supplier: Anaspec Inc

Sale

Description: Biotin-TAT (47-57), HIV-derived cell penetrating TAT peptide, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): Biotin-YGRKKRRQRRR, Molecular Weight: 1786.2, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-416

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 38), mouse, rat, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4035.5, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-364

Supplier: Anaspec Inc

Sale

Description: TAT-HA2 Fusion Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3433, Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG, amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-568

Supplier: Anaspec Inc

Sale