You Searched For: Hytest Ltd

Description: [Lys(Me3)4]-Histone H3 (1-10), H3K4(Me3), Sequence: ART-K(Me3)-QTARKS, Purity: By HPLC greater than or equal to 95%, This peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-4, Molecular Weight:, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-020

Supplier: Anaspec Inc

Sale

Description: WAAG - 3R, Aggrecanase (ADAM - TS - 4) FRET Substrate, Purity: By HPLC >/= 95%, MW: 1644.8, Sequence: (One-Letter Code): Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2, Appearance: Lyophilized yellow powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-926

Supplier: Anaspec Inc

Sale

Description: Thrombin Receptor Activator for Peptide 6 (TRAP-6), Purity: HPLC >/= to 95%, Molecular Weight: 748.9, Sequence: H-Ser-Phe-Leu-Leu-Arg-Asn-OH, This peptide forms the N-terminal sequence left after thrombin cleavage, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-472

Supplier: Anaspec Inc

Sale

Description: Big Endothelin 1 (1-39), porcine, Purity: HPLC >/= 95%, Molecular Weight: 4384.1, Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS, This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide, Storage: -20 deg C, Size: 1mg

Catalog Number: 102996-096

Supplier: Anaspec Inc

Sale

Description: Transportan a 27 amino acids (aa) long chimeric peptide containing 12 aa from the amino-terminal part of the neuropeptide galanin, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GWTLNSAGYLLGKINLKALAALAKKIL, MW: 2841.5, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-484

Supplier: Anaspec Inc

Sale

Description: Angiotensin II, peptide human, Purity: HPLC >/= to 95%, Molecular Weight: 1046.2, Sequence: H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH, Appearance: Lyophilized white powder, exerts a wide range of effects on the cardiovascular system, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-066

Supplier: Anaspec Inc

Sale

Description: NBD-X, Synonym: 6-(N-(7-Nitrobenz-2-oxa-1,3-diazol-4-yl)amino)hexanoic acid, building block that can be used to prepare peptide conjugates and other bioconjugate, Molecular Weight: 294.27, Spectral Properties: Abs/Em = 467/539 nm, Solvent System: DMSO, Size: 100mg

Catalog Number: 103010-902

Supplier: Anaspec Inc

Sale

Description: Temporin L, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1640, Sequence: FVQWFSKFLGRIL-NH2, hydrophobic peptide amide derived from the frog Rana temporaria, active against Gram-positive /negative bacteria and E. Coli, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-478

Supplier: Anaspec Inc

Sale

Description: Endothelin 1, human, porcine, sequence: CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11), Purity: HPLC greater than or equal to 95%, Molecular Weight: 2492, potent vasoconstrictor peptide derived from endothelial cells, Size: 0.25 mg

Catalog Number: 102999-368

Supplier: Anaspec Inc

Sale

Description: Amyloid-Forming Peptide, Sequence: GNNQQNY, Purity: By HPLC greater than or equal to 95%, This is a heptapeptide from the N-terminal prion-determining domain of the yeast protein Sup35 that forms amyloid fibrils, Molecular Weight: 836.8, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-514

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-38), Human, Purity: HPLC >/= 95%, Molecular Weight: 4131.6, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-490

Supplier: Anaspec Inc

Sale

Description: IRBP derived peptide, R16, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1473.6, Sequence: ADGSSWEGVGVVPDV, Appearance: Powder, IRBP (Interphotoreceptor retinoid binding protein) derived peptide, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-232

Supplier: Anaspec Inc

Sale

Description: MOG (1 - 125), Recombinant protein, Source: Mouse, Purity: Greater than 95% (SDS-PAGE), Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL), quantitative kinetic assay, Application: ELISA, Size: 100ug

Catalog Number: 103004-644

Supplier: Anaspec Inc

Sale

Description: E - V1 - 2, E - PKC Inhibitor, Sequence: EAVSLKPT, Purity: HPLC >/= 95%, derived from residues 14-21 of protein kinase C C2 (EPKC C2), specifically inhibits EPKC by disrupting PKC binding to its receptor, Molecular Weight: 844, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-226

Supplier: Anaspec Inc

Sale

Description: [Thr28, Nle31]-Cholecystokinin (25-33), sulfated, Purity: HPLC >/= 95%, Molecular Weight: 1251.3, Sequence: H-Arg-Asp-Tyr(SO3H)-Thr-Gly-Trp-Nle-Asp-Phe-NH2, Appearance: Powder, Storage: -20 deg C, Size: 1mg

Catalog Number: 102996-332

Supplier: Anaspec Inc

Sale

Description: VIP (1-12), human, porcine, rat, Purity: HPLC >/- 95%, Molecular Weight: 1425.5, Sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-OH, this peptide fragment 1-12 with a mass of 1425.5 da, is mostly used as a standard in mass spectrometry, Size: 1 mg

Catalog Number: 103003-696

Supplier: Anaspec Inc

Sale