You Searched For: Hytest Ltd


2,094  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"2094"
Description: Caerulein
Catalog Number: 103003-710
Supplier: Anaspec Inc


Description: Calcein AM ≥95% (by HPLC) fluorescent dye
Catalog Number: 103011-396
Supplier: Anaspec Inc


Description: SensoLyte* 490 MMP-9 Assay Kit *Fluorimetric*, Components: MMP-9 substrate 270 ul, EDANS 1 mM DMSO solution, 10ul, APMA 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed
Catalog Number: 103010-160
Supplier: Anaspec Inc


Description: Dynorphin A (1-8), porcine, Purity: HPLC >/= 95%, Molecular Weight: 981.2, Sequence: H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH, Appearance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-530
Supplier: Anaspec Inc


Description: [Lys(Ac)14/18/23]-Histone H3 (1-24)-GGK(Biotin), Purity: HPLC >/= 95%, Molecular weight: 3149.7, acetylated at Lys14, Lys18, and Lys23, Sequence: [ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AGG-K(Biotin)], biotin - labeled, Store: -20 deg C, Size: 1mg
Catalog Number: 103009-174
Supplier: Anaspec Inc


Description: Histone H4 (1 - 20), PRMT7 Substrate, M1, Sequence: SGRGKGGKGLGKGGAKRHRK - NH2, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1991.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-370
Supplier: Anaspec Inc


Description: S. pneumoniae CFP10 (71–85)
Catalog Number: 103006-902
Supplier: Anaspec Inc


Description: [Lys(Me1)36]-Histone H3 (31-41), H3K36(Me1), Sequence: STGGV-K(Me1)-KPHRY, Purity: By HPLC >/= 95%, This peptide is Histone H3 amino acid residues 31 to 41 mono-methylated at Lys-36, Molecular Weight: 1243.4, Storage: -20 C, Size: 1 mg
Catalog Number: 103008-036
Supplier: Anaspec Inc


Description: Hoechst 33258, 20 mM solution in water, CAS: 23491-45-4, Cell-permeant DNA minor groove binding dye, MW: 533.88, Spectral Properties: Abs/Em = 352/461 nm, MF: C25H24N6O.3HCl.5H2O, Appearance: Yellow liquid, Storage: -20 deg C Store away from oxidizing agent, Size: 5 ml
Catalog Number: 103011-144
Supplier: Anaspec Inc


Description: HiLyte* Fluor 750 C2 maleimide, Spectrally similar to Cy7 dye, longest-wavelength thiol-reactive HiLyte* Fluor dye, Molecular Weight: 1222.5, Spectral Properties: Abs/Em = 754/778 nm, Solvent System: Water or DMF, Physical State: Solid, Storage -20C, Size: 1 mg
Catalog Number: 103010-952
Supplier: Anaspec Inc


Description: 5(6) - CFDA, SE, Synonym: 5 - (and - 6) - Carboxyfluorescein diacetate, succinimidyl ester Mixed Isomers; 5(6) - CFDA, NHS ester, Reactive pH indicator for slightly acidic pH range, MW: 557.5, Spectral Properties: Abs/Em = 492/517 nm, Solvent System: DMSO, Size: 25 mg
Catalog Number: 103011-388
Supplier: Anaspec Inc


Description: [Arg6]-beta-Amyloid (1-40), English Mutation, Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC greater than or equal to 95%, amino acids 1 to 42 beta-amyloid with the England mutation, Molecular Weight: 4533.2, Size: 0.5 mg
Catalog Number: 103007-606
Supplier: Anaspec Inc


Description: Human Sirtuin 2, Recombinant, Sirtuins comprise a unique class of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases (class III HDACs) targeting multiple protein substrates, belongs to the family of Sir2, Storage: -80 deg C, Size: 10 ug
Catalog Number: 103010-584
Supplier: Anaspec Inc


Description: EMP17, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2483.9, Sequence: (One-Letter Code) FITC-LC-TYSCHFGPLTWVCKPQGG, fluorescent (FITC)-labeled Erythropoietin (EPO)-mimetic peptide (EMP17), Abs/Em=494/520 nm, Storage: At -20 Degree C, Size: 1mg
Catalog Number: 103002-744
Supplier: Anaspec Inc


Description: GRGDS, AnaSpec
Catalog Number: 103006-344
Supplier: Anaspec Inc


Description: Srctide, Sequence: GEEPLYWSFPAKKK-NH2, Purity: By HPLC greater than or equal to 95%, peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Molecular Weight: 1678, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-838
Supplier: Anaspec Inc


-15 - 0 of 2,094