You Searched For: Hytest Ltd

Description: SensoLyte* 520 HIV Protease Assay Kit *Fluorimetric*, Components: HIV-1 protease FRET substrate 120 ul, HiLyte Fluor*488 100 u
M, 5 ul, Pepstatin A 27.4 u
g powder, 2X Assay buffer 20 mL, Stop solution 10 mL, DMSO 50 ul, DTT 1 M, 150 ul, storage: -20 deg C

Catalog Number: 103010-178

Supplier: Anaspec Inc

Sale

Description: [Ser(OGlcNAc)]400-KWK-Tau (388-411)-KK(Biotin)-NH2, Purity: HPLC >/= 95%, MW: 3677.3, Sequence: [KWKHGAEIVYKSPVV-S(OGlcNAc)-GDTSPRHLSNVK-K(biotin)-NH2], Store: -20 deg C, Size: 1mg

Catalog Number: 103009-512

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-13), human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1561.6, Sequence: DAEFRHDSGYEVH, H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-OH, Appearance: Powder, peptide is beta-Amyloid, human sequence, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-192

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (1-42), HiLyte Fluor® 555

Catalog Number: 103003-170

Supplier: Anaspec Inc

Sale

Description: SAMS Peptide, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1778.2, Sequence: (one-Letter Code) HMRSAMSGLHLVKRR - NH2, synthetic peptide substrate specific for AMP-activated protein kinase (AMPK), Storage: At -20 Degree C, Size: 5mg

Catalog Number: 103002-738

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (25 - 35), scrambled, Human, mouse/rat, Sequence: MAKGINGISGL, Purity: By HPLC greater than or equal to 95%, used to recognize its structure and functions, Molecular Weight: 1060.3, Apperance: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-120

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-15), Human, Purity: HPLC >/= 95%, Sequence (1-Letter Code): DAEFRHDSGYEVHHQ, Sequence (3-Letter Code): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH, Molecular weight: 1826.9, Physical State: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103006-990

Supplier: Anaspec Inc

Sale

Description: AMC [7-Amino-4-methylcoumarin], Molecular Formula: C10H9NO2, Molecular Weight: 175.2, Appearance: Solid, Coumarin 120; coumarin 440, Storage: -20 deg C, Size: 1 g

Catalog Number: 103003-516

Supplier: Anaspec Inc

Sale

Description: MOG (1 - 125), Recombinant protein, Source: Mouse, Purity: Greater than 95% (SDS-PAGE), Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL), quantitative kinetic assay, Application: ELISA, Size: 500ug

Catalog Number: 103004-648

Supplier: Anaspec Inc

Sale

Description: Congo Red, UltraPure Grade, Early diagnosis and classification of amyloid deposition, Molecular Weight: 696.7, Spectral Properties: Abs/Em = 497/NA nm, Solvent System: Water, CAS number: 573-58-0, Molecular formula: C32H22N6Na2O6S2, Physical State: Solid, Storage: -20 deg C, Size: 1 g

Catalog Number: 103011-118

Supplier: Anaspec Inc

Sale

Description: MOG (1 - 125), Recombinant protein, Source: Mouse, Purity: Greater than 95% (SDS-PAGE), Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL), quantitative kinetic assay, Application: ELISA, Size: 100ug

Catalog Number: 103004-644

Supplier: Anaspec Inc

Sale

Description: E - V1 - 2, E - PKC Inhibitor, Sequence: EAVSLKPT, Purity: HPLC >/= 95%, derived from residues 14-21 of protein kinase C C2 (EPKC C2), specifically inhibits EPKC by disrupting PKC binding to its receptor, Molecular Weight: 844, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-226

Supplier: Anaspec Inc

Sale

Description: HEL (46-61), Purity: HPLC >/- 95%, Molecular Weight: 1753.9, Sequence: H-Asn-Thr-Asp-Gly-Ser-Thr-Asp-Tyr-Gly-Ile-Leu-Gln-Ile-Asn-Ser-Arg-OH, This peptide is amino acids 46 to 61 fragment of the hen egg lysozyme, also used in in MHC related studies, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-186

Supplier: Anaspec Inc

Sale

Description: WAAG - 3R, Aggrecanase (ADAM - TS - 4) FRET Substrate, Purity: By HPLC >/= 95%, MW: 1644.8, Sequence: (One-Letter Code): Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2, Appearance: Lyophilized yellow powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-926

Supplier: Anaspec Inc

Sale

Description: Corticotropin Releasing Factor, CRF, human, rat, Purity: HPLC >/- 95%, Molecular Weight: 4757.5, Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-714

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Cathepsin K Assay Kit *Fluorimetric*, Cathepsin K substrate 2 mM, 50 ul, HiLyte Fluor* 488 1 mM, 10 ul, Procathepsin K 0.15 mg/mL, 10 ul, Assay Buffer 20 mL, Cathepsin K buffer 100 ul, Cathepsin K Inhibitor 100 u
M, 10 ul, DTT 1 M, 200 ul

Catalog Number: 103010-546

Supplier: Anaspec Inc

Sale