Print…

You Searched For: Hytest Ltd


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-103008-166

[Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin) H3K36(Me2) 0.25mg

Description: [Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2945.5, Sequence: ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin), Label: Biotin, Storage: -20 degree C, Size: 0.25mg
Catalog Number: 103008-166
Supplier: Anaspec Inc
Image Unavailable-102999-820

Biotin - LC - beta - Amyloid (1 - 40) 1 mg

Description: Biotin - LC - beta - Amyloid (1 - 40), Human, Sequence: Biotin - LC - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4669.3, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102999-820
Supplier: Anaspec Inc
Image Unavailable-103008-062

OVA-Q4 Peptide, pQ4, OVA (257-264) Variant   1 mg

Description: OVA-Q4 Peptide, pQ4, OVA (257-264) Variant  , Sequence: SIIQFEKL, Purity: By HPLC greater than or equal to 95%, variant of the agonist ovalbumin (OVA) peptide (257-264), Molecular Weight: 977.2, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103008-062
Supplier: Anaspec Inc
Image Unavailable-103007-122

Beta - Amyloid (22 - 42) 1 mg

Description: Beta - Amyloid (22 - 42), Human, mouse/rat, Sequence: EDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42, Molecular Weight: 1999.4, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-122
Supplier: Anaspec Inc
Image Unavailable-103007-782

gp91 ds-tat FAM labeled 0.5 mg

Description: gp91 ds-tat, FAM labeled, Sequence: 5-FAM-YGRKKRRQRRRCSTRIRRQL-NH2, Purity: By HPLC greater than or equal to 95%, FAM labeled peptide (Abs/Em=492/518 nm), Molecular Weight: 3031.5, Apperance: powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-782
Supplier: Anaspec Inc
Image Unavailable-103010-822

5-ROX, SE 5 mg

Description: 5-ROX, SE, Synonym: 5-Carboxy-X-rhodamine, succinimidyl ester; 5-ROX, NHS ester, Single isomer, for labeling peptides and nucleotide, CAS: 209734-74-7, Purity: 95%, MW: 631.67, Spectral Properties: Abs/Em = 573/602 nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103010-822
Supplier: Anaspec Inc
Image Unavailable-103008-450

BMP-2 Knuckle Epitope (73-92) 1mg

Description: BMP-2 Knuckle Epitope (73-92), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2118.5, Sequence: KIPKASSVPTELSAISTLYL, amino acids 73 to 92 fragment of bone morphogenetic protein (BMP) knuckle epitope, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-450
Supplier: Anaspec Inc
Image Unavailable-103009-960

KALA

Description: KALA
Catalog Number: 103009-960
Supplier: Anaspec Inc
Image Unavailable-103008-168

[Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin) H3K36(Me2) 1mg

Description: [Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2945.5, Sequence: ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-168
Supplier: Anaspec Inc
Image Unavailable-103010-782

6-FAM, SE 100 mg

Description: 6-FAM, SE, isomer of carboxyfluorescein, CAS Number: 92557-81-8, Synonym: 6-Carboxyfluorescein, succinimidyl ester; 6-FAM, NHS ester, Molecular Weight: 473.39, Molecular Formula: C25H15NO9, Spectral Properties: Abs/Em = 495/517nm, Solvent System: DMF/DMSO, form: Solid, Size: 100 mg
Catalog Number: 103010-782
Supplier: Anaspec Inc
Image Unavailable-103009-380

Histone H3 (69-89)-K(Biotin)

Description: Histone H3 (69-89)-K(Biotin), Purity: HPLC >/= 95%, MW: 2834.3, Sequence: [RLVREIAQDFKTDLRFQSSAV-K(Biotin)] biotinylated through the epsilon side chain of a C-terminal Lys. Provided at >95% peptide purity, biotin - labeled, Store: -20 deg C, Size: 1mg
Catalog Number: 103009-380
Supplier: Anaspec Inc
Image Unavailable-103006-094

Peptide Mass Spec Standard kit

Description: Peptide Mass Spec Standard kit, Purity: HPLC >/= 95%, Consists of two calibration mixtures for calibrating mass scale in ESI mass spectrometry. Calibration Mixture 1: 800 to 1800 daltons, (2): 1800 to 3800 daltons, Appearance: Off-white solid, Storage: -20 degree C
Catalog Number: 103006-094
Supplier: Anaspec Inc
Image Unavailable-103007-366

[Met(O)35] - beta - Amyloid (1 - 42) 0.5 mg

Description: [Met(O)35] - beta - Amyloid (1 - 42), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL - M(O) - VGGVVIA, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4530.1, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-366
Supplier: Anaspec Inc
Image Unavailable-103010-904

NBD-X, succinimidyl ester ≥95% (by HPLC)

Description: NBD-X, succinimidyl ester ≥95% (by HPLC)
Catalog Number: 103010-904
Supplier: Anaspec Inc
Image Unavailable-103003-274

TET 830 modified 1 mg

Description: TET 830 modified/T-helper epitope from tetanus toxoid, Purity: HPLC >/- 95%, Molecular Weight: 1797.2, Sequence: H-Ala-Gln-Tyr-Ile-Lys-Ala-Asn-Ser-Lys-Phe-Ile-Gly-Ile-Thr-Glu-Leu-OH, Appearance: Lyophilized white powder, It induces T-cell activation, Size: 1 mg
Catalog Number: 103003-274
Supplier: Anaspec Inc
Image Unavailable-103008-962

SensoLyte* 520 TACE (Alpha-Secretase) Activity Assay Kit

Description: SensoLyte* 520 TACE (A-Secretase) Activity Assay Kit, Fluorimetric, Contains: QXL* 520, TACE substrate, 5-FAM, fluorescence reference standard, Assay Buffer, Inhibitor of TACE, Stop Solution, Storage: -20 deg C, Size: 100 Assay(96-well plate)
Catalog Number: 103008-962
Supplier: Anaspec Inc
-31 - -16 of 2,094