3,404  results were found

SearchResultCount:"3404"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (76762-548)
Supplier: Prosci


Catalog Number: (77213-116)
Supplier: ANTIBODIES.COM LLC


Catalog Number: (RL600-401-994)
Supplier: Rockland Immunochemical
Description: Cancer Primary Antibody Anti-Rab11 Family-Interacting Protein 3 (FIP3) [Rabbit] has been tested by Western Blot, ELISA, IP Rockland Immunochemicals can also Custom Produce Antibodies for your Research


Catalog Number: (89335-800)
Supplier: Genetex
Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human, Mouse Tested Applications: IHC-P, WB Pkg Size: 100 ul


Catalog Number: (10568-608)
Supplier: Abnova
Description: RAB11A polyclonal antibody (A01), Mouse polyclonal antibody raised against a full-length recombinant RAB11A, Size: 50ul


Catalog Number: (77438-776)
Supplier: Bioss


Catalog Number: (10164-778)
Supplier: Genetex
Description: Polyclonal RAB-14 antibody Host: Rabbit, Species reactivity: rat, Isotype: IgG, Immunogen: KLH conjugated synthetic peptide derived from human RAB-14, Synonym: FBP Antibody, RAB14, member RAS oncogene family Antibody, RAB14 Antibody


Catalog Number: (10348-674)
Supplier: Bioss
Description: RAB-14 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: CAS3; CASS3; EFS1; EFS2; Embryonal Fyn associated substrate, Application: IHC-P, IF(IHC-P), 100ul


Catalog Number: (76174-486)
Supplier: Boster Biological Technology
Description: RAB14 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 124-153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA, Synonyms: Ras-related protein Rab-14, RAB14, Application: Western Blot, storage: -20 deg C, size: 100ug/vial


Catalog Number: (103336-464)
Supplier: Novus Biologicals
Description: Rab11 Polyclonal Antibody 0.05mg, Host: Mouse, Species: Human, Isotype: IgG, Immunogen: RAB11B (NP-004209, 1 a.a. - 218 a.a) full-length human protein, Synonym: GTP-binding protein YPT3


Catalog Number: (103663-176)
Supplier: Sino Biological
Description: RAB11B (His Tag), Recombinant protein, Purity: > 95 % as determined by SDS-PAGE, Host: HEK293 Cells, Species: Human, Molecular Mass: The recombinant human RAB11B consists 233 amino acids and predicts a molecular ma


Catalog Number: (77059-810)
Supplier: ANTIBODIES.COM LLC


Catalog Number: (10624-992)
Supplier: Abnova
Description: RAB11B monoclonal antibody (M03A), clone 2F1, Mouse monoclonal antibody raised against a partial recombinant RAB11B, Size: 200ul


Catalog Number: (10348-688)
Supplier: Bioss
Description: RAB-14 Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: CAS3; CASS3; EFS1; EFS2; Embryonal Fyn associated substrate, Application: IHC-P, IF(IHC-P), 100ul


Catalog Number: (77059-814)
Supplier: ANTIBODIES.COM LLC


Catalog Number: (10598-838)
Supplier: Abnova
Description: RAB11A monoclonal antibody (M07), clone S1, Mouse monoclonal antibody raised against a full-length recombinant RAB11A, Size: 100ug


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-79 - -64 of 3,404
no targeter for Bottom