Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103008-532

Histone H4 (1-23)-GSGSK, Biotin

Catalog Number: (103008-532)
Supplier: Anaspec Inc
Description: This peptide consists of amino acids 1-23 of histone H4 attached at the C-terminal by a GSGS linker to biotinylated lysine. It is used as a substrate for histone acetyltransferase (HAT) assays. Biotinylation allows the peptide to be captured on streptavidin or agarose beads.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GSGSK(Biotin)
MW:3003.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103001-640

Anti-Mouse/ Rat β-Amyloid (1-42) Quantitative ELISA (Colorimetric), AnaSpec

Catalog Number: (103001-640)
Supplier: Anaspec Inc
Description: This SensoLyte® high-sensitivity (2pg/mL) beta-Amyloid (1-42) Quantitative ELISA Kit (Mouse/Rat) provides a convenient and quantitative assay for determining mouse/rat beta-Amyloid (1-42) (Aβ42) amount in cell and tissue lysate as well as in body fluids
Image Unavailable-103010-638

AggreSure™ Human Beta-Amyloid (1-40)

Catalog Number: (103010-638)
Supplier: Anaspec Inc
Description: AnaSpec's AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using AnaSpec's SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103010-524

SensoLyte® AMC tPA Activity Assay Kit (Fluorimetric), AnaSpec

Catalog Number: (103010-524)
Supplier: Anaspec Inc
Description: Tissue-type plasminogen activator (tPA) is a serine protease that cleaves pro-enzyme plasminogen into active plasmin
Image Unavailable-103003-360

Rat alpha-Calcitonin Gene Related Peptide

Catalog Number: (103003-360)
Supplier: Anaspec Inc
Description: α-CGRP is preferentially expressed in sensory neuron. Both alpha-CGRP and beta-CGRP increase the rate and force of atrial contractions.
Sequence:SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
MW:3806.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-518

Human LL-37 fragment (18-37)

Catalog Number: (103007-518)
Supplier: Anaspec Inc
Description: This is fragment 18-37 of LL-37, it exhibits enhanced antimicrobial activity. Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense (innate immunity) against local infection and systemic invasion of pathogens at sites of inflammation and wounds.
Sequence: KRIVQRIKDFLRNLVPRTES
MW: 2468.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103011-034

5-TAMRA Lysine

Catalog Number: (103011-034)
Supplier: Anaspec Inc
Description: This product is a very useful building block and a good transglutaminase substrate.
Image Unavailable-103008-564

L. monocytogenes LLO (91-99)

Catalog Number: (103008-564)
Supplier: Anaspec Inc
Description: This peptide is the H2-Kd-restricted epitope of Listeriolysin O (LLO), consisting of amino acids 91 to 99. LLO is necessary for Listeria monocytogenes to escape the vacuoles of host cells and enter the cytoplasm during infection. This fragment has been shown to be a potential vaccine candidate against L. monocytogenes by eliciting a CTL response in vivo.
Sequence:GYKDGNEYI
MW:1058.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-692

Human Scrambled Jag1

Catalog Number: (103006-692)
Supplier: Anaspec Inc
Description: This peptide is scrambled sequence of JAG-1 (188-204), Jagged-1 (188-204), Notch Ligand, DSL Peptide, cat# 61298.Related Product: JAG-1 (188-204), Jagged-1 (188-204), Notch Ligand, DSL Peptide, cat# 61298.
Sequence: RCGPDCFDNYGRYKYCF
MW: 2107.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103008-028

Histone H3 (23-34)

Catalog Number: (103008-028)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 23 to 34.
Sequence:KAARKSAPATGG
MW:1114.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-662

SensoLyte® 520 Neprilysin Activity Assay Kit (Fluorimetric), AnaSpec

Catalog Number: (103010-662)
Supplier: Anaspec Inc
Description: Neprilysin (NEP) is a transmembrane metallopeptidase normally expressed by a variety of tissues
Image Unavailable-103007-304

GRGDS, LC-biotin labeled, Biotin, AnaSpec

Catalog Number: (103007-304)
Supplier: Anaspec Inc
Description: The GRGDS peptide contains the amino acid sequence Arg-Gly-Asp (RGD), which has been implicated as a recognition site in interactions between extracellular matrix (ECM) molecules and cell membrane receptors. RGD-containing synthetic peptides are known to inhibit attachment of endothelial cells to substrates. GRGDS peptide inhibits angiogenesis in serum-free collagen gel culture. This synthetic peptide mimics the cellular binding site of many adhesive proteins in the extracellular matrix and causes rounding and detachment of spread cells. This peptide is biotinylated through 6-aminohexanoate (LC) as a spacer.
Sequence:Biotin-LC-GRGDS
MW:830 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-988

Cathepsin D and E FRET Substrate

Catalog Number: (103006-988)
Supplier: Anaspec Inc
Description: Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown. Cathepsin D is involved in the pathogenesis of several diseases such as breast cancer and Alzheimer disease. Cathepsin E is a non-lysosomal aspartic proteinase of the pepsin superfamily. It plays an important role in the protein degradation, the generation of bioactive proteins, and antigen processing. Recent studies have particularly suggested that Cathepsin E is important in host defense against cancer cells and invading microorganisms.
An internally quenched fluorogenic substrate (Ab/Em =328/393 nm) for cathepsins D and E and not for B, H or L, obtained from the hepatopancreas (liver) of the Japanese common squid (Todarodes pacificus). The cleavage occurs at the Phe-Phe amide bond resulting in enhanced fluorescence and is used in screening cathepsin D and E inhibitors and for determining cathepsin D and E activity in tissue cell extracts.
Sequence:Mca-GKPILFFRLK(Dnp)-r-NH2
MW:1756.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-794

6-HEX, SE

Catalog Number: (103010-794)
Supplier: Anaspec Inc
Description: 6-HEX, SE is a popular amino-reactive fluorescent probe that is widely used in nucleic acid sequencing and related research.
Image Unavailable-103007-588

Leech Hirudin (54-65)

Catalog Number: (103007-588)
Supplier: Anaspec Inc
Description: This is amino acids 54 to 65 fragment of sulfated hirudin, a 65-residue peptide. Hirudin is found in the saliva of the leech Hirudo medicinalis. This sulfated peptide binds tightly to anion-binding exosite I of thrombin, but does not inhibit hydrolysis of synthetic peptide substrates.
Sequence:Ac-GDFEEIPEE-Y(SO3H)-LQ
MW:1590.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103008-216

Human [Met]-beta-Amyloid (1-42), TAMRA (5-Carboxytetramethylrhodamin)

Catalog Number: (103008-216)
Supplier: Anaspec Inc
Description: This is b-amyloid (1-42) peptide with an N-terminal methionine is labeled with a fluorescent dye, 5-TAMRA (Ex/Em= 544/572 nm), on the N-terminus.
Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 5057.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
289 - 304 of 1,910
no targeter for Bottom