You Searched For: honeywell+deblocking

Description: This GluR23Y peptide was used in ELISA cell-surface assay for the insulin-stimulated endocytosis of native AMPA receptors in cultured hippocampal neurons. GluR23Y prevented any insulin-induced reduction. The blockade of insulin action was observed when the GluR23Y peptide was delivered into neurons by fusing it to the membrane transduction domain of HIV-1.
Sequence:YKEGYNVYG
MW:1092.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-392

Supplier: Anaspec Inc

Sale

Description: Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavage

Catalog Number: 103011-356

Supplier: Anaspec Inc

Sale

Description: This peptide is a substrate for p70 ribosomal S6 kinase.
Sequence:KKRNRTLTV
MW:1115.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-790

Supplier: Anaspec Inc

Sale

Description: DPPIV is a widely distributed serine protease that cleaves two amino acids from small peptides containing alanine or proline in the second position of the N-terminus of the peptide

Catalog Number: 103010-600

Supplier: Anaspec Inc

Sale

Description: A more potent suppressor of neuronal cell death than humanin (HN), 10nM of this Gly14 substituted HN blocked cytotoxicity compared to 10uM of HN.
Sequence:MAPRGFSCLLLLTGEIDLPVKRRA
MW:2657.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-054

Supplier: Anaspec Inc

Sale

Description: Substitution of Ser 26 with Cys in Aβ1-40 allows the generation of the covalently linked Aβ40 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Molecular Weight: 4345.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103007-636

Supplier: Anaspec Inc

Sale

Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4344.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 102996-086

Supplier: Anaspec Inc

Sale

Description: HiLyte™ Fluor 532 hydrazide is a carbonyl-reactive fluorescent labeling dye.

Catalog Number: 103011-414

Supplier: Anaspec Inc

Sale

Description: This peptide is a fragment of myelin basic protein (MBP), which corresponds to amino acids 88-102 in mouse, 88-104 in guinea pig and 89-105 in human. It is acetylated in N-term.
Sequence:Ac-FFKNIVTPRTPPPSQGK-NH2
MW:1956 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-110

Supplier: Anaspec Inc

Sale

Description: This peptide, a double cyclic peptide, binds preferentially to integrins at sites of tumor angiogenesis and inflammed synovium in-vivo, and can be internalized into targeted cells.
Sequence:ACDCRGDCFCG (Disulfide bridge: 2-10 and 4-8)
MW:1145.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103005-328

Supplier: Anaspec Inc

Sale

Description: Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20. It is considered to be a generic substrate for various TPKs.
Sequence:5-TMR-KVEKIGEGTYGVVYK
MW:2082.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102997-410

Supplier: Anaspec Inc

Sale

Description: A linear integrin binding peptide. It inhibits endothelial cell adhesion to fibroblast growth factor-2 and to fibronectin.
Sequence:GRGDSPK
MW:715.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-348

Supplier: Anaspec Inc

Sale

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This substrate is hydrolyzed rapidly by MMP-13, but slowly by MMP-1, 2, 3, 8, 9 and 12, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-PLGLWArK(5-FAM)-NH2
MW:1789.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-238

Supplier: Anaspec Inc

Sale

Description: APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-180

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H4 amino acids 1 to 16, acetylated at Lys-16 and at the N-terminus. This peptide also contains a GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that play a crucial role in amplifying the binding of transcription factors to specific recognition sites within the nucleosome.
Sequence:Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-536

Supplier: Anaspec Inc

Sale

Description: Serine/threonine phosphatase substrate.
Sequence:KR-pT-IRR
MW:909 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102998-170

Supplier: Anaspec Inc

Sale