You Searched For: VEL CHEMICALS DECONDITIONERING

Description: [Lys(Me1)20]-Histone H4 (8-30)- WGK(Biotin); H4K20(Me1), Purity: HPLC >/= 95%, MW: 3156.7, Sequence: [Ac-KGLGKGGAKRHR-K(Me1)-VLRDNIQGIT-WGK(biotin)] amino acid residues 8-30 with a C-terminal WG linker biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-608

Supplier: Anaspec Inc

Sale

Description: Somatostatin 28, human, sheep, cow, rat, mouse, pig, Purity: HPLC >/= to 95%, Molecular Weight: 3148.6, Sequence: SANSNPAMAPRERKAGCKNFFWKTFTSC, is a cyclic peptide existing in two isoforms and is produced in the pancreas islet, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-328

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate XI, Purity: % Peak Area By HPLC >/= 95%, MW: 1567.6, Sequence: (One-Letter Code): 5-FAM-P-Cha-G-Nva-HA-Dap(QXL* 520)-NH2 A sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm, Size: 0.1 mg

Catalog Number: 103005-936

Supplier: Anaspec Inc

Sale

Description: PKG Substrate [RKRSRAE], Glasstide, Purity: HPLC >/- 95%, Molecular Weight: 902, is a selective substrate for protein kinase G (PKG) with a strong preference for PKG Ia, The Vmax/Km of the peptide substrate is significantly increased by peptide-546, Size: 1 mg

Catalog Number: 103003-092

Supplier: Anaspec Inc

Sale

Description: ACTH (1 - 39), human, cleavage product from a larger precursor proopiomelanocortin (POMC), Purity % Peak Area By HPLC >/=95%, Molecular Weight 4541.1, Sequence (One-Letter Code): SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, Physical State: Powder, Storage -20 deg C, Size: 1mg

Catalog Number: 102998-422

Supplier: Anaspec Inc

Sale

Description: [pSer10), Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), biotin-labeled, Sequence: ARTKQTARK-pS-TGG-K(Ac)-APRKQLAGGK(Biotin), Purity: By HPLC >/= 95%,residues 1 to 21 phosphorylated at Ser-10, Molecular Weight: 2845.3, Size: 0.25 mg

Catalog Number: 103007-996

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Homogeneous Rh110 Caspase-3/7 Assay Kit, Components: Rh110 Caspase-3/7 substrate 250 ul, Rh110 1 mM DMSO solution, 40 ul, Ac-DEVD-CHO 5 mM DMSO solution, 10 ul, Assay buffer 30 mL, DTT 1 M, 1.1 mL, 10X Lysis Buffer 20 mL

Catalog Number: 103010-170

Supplier: Anaspec Inc

Sale

Description: ACTH (1-17), Purity: HPLC >/- 95%, Molecular Weight: 2093.4, Sequence: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH, Appearance: Powder, ACTH (1–17), and aMSH, both derived from POMC are involved in melanogenesis, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-356

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 MMP-9 Assay Kit *Fluorimetric*, Components: MMP-9 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability

Catalog Number: 103010-240

Supplier: Anaspec Inc

Sale

Description: Poly-Y-D-Glutamic Acid Construct, Sequence: Ac-(Y-e)15-C-NH2, Purity: By HPLC greater than or equal to 95%, capsule inhibits innate host defense through its antiphagocytic action, Molecular Weight: 2099, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-710

Supplier: Anaspec Inc

Sale

Description: TAT (47-57), FAM-labeled fluorescent, Absorbance /Em = 494/521 nm, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): FAM-YGRKKRRQRRR, Molecular Weight: 1918.2, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-418

Supplier: Anaspec Inc

Sale

Description: C-Peptide-2, rat, Sequence: EVEDPQVAQLELGGGPGAGDLQTLALEVARQ, Purity: By HPLC greater than or equal to 95%, This rat C-peptide-2 differs from the active human C-peptide by several amino acids, Molecular Weight: 3161.5, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 103007-682

Supplier: Anaspec Inc

Sale

Description: JAG-1 (188-204), Jagged-1 (188-204), Notch Ligand, DSL Peptide induces epidermal maturation, Purity: HPLC>/=95%, Sequence (One-Letter Code): CDDYYYGFGCNKFCRPR, Molecular weight: 2107.4, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-554

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Green SIRT2 Assay Kit *Fluorimetric*, Components: SIRT2 substrate 1 mM, 100 uL, Deacetylated reference substrate 1 mM, 20 uL, SIRT2 0.25 mg/mL, 40 uL, Assay Buffer 20 mL, NAD+ 50 mM, 100 uL, Nicotinamide 30 mM, 0.5 mL, SIRT2 Developer (10X) 0.5 mL

Catalog Number: 103010-586

Supplier: Anaspec Inc

Sale

Description: Parathyroid Hormone (1-13), Purity: HPLC >/= 95%, MW: 1455.7, Sequence: [SVSEIQLMHNLGK], represents the N-terminus of the parathyroid hormone (PTH) and can be used to represent full length PTH in studying the specificity of assays, Store: -20 deg C, Size: 5mg

Catalog Number: 103009-492

Supplier: Anaspec Inc

Sale

Description: TAT-GluR23A Fusion Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2357.7, Sequence: YGRKKRRQRRRAKEGANVAG, control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-148

Supplier: Anaspec Inc

Sale