Print…

You Searched For: Hobré Instruments BV


3,665  results were found

Refine Results Sort by
SearchResultCount:"3665"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-H-3105.0005BA

Human Minigastrin I

Supplier: Bachem Americas
Description: HG-13, LEEEEEAYGWMDF-amide, has been isolated from tumor tissue. The peptide corresponds to the fragment 5-17 of human gastrin I.

Image Unavailable-G-2995.0250BA

H-Pro-Asn-OH

Supplier: Bachem Americas
Description: 1G CAS: 107856-82-6 C9H15N3O4 FW: 229.24

Image Unavailable-E-3085.0005BA

H-ARG(PMC)-OtBu

Supplier: Bachem Americas
Description: Sequence: H-Arg(Pmc)-OtBu (free base)

Image Unavailable-C-1945.0005BA

N(α)-Cbz-L-histidine

Supplier: Bachem Americas
Description: Sequence: Z-His-OH

Image Unavailable-D-2415.0001BA

Hydroxylamine-Wang resin 200-400 mesh

Supplier: Bachem Americas
Description: For the synthesis of hydroxamic acids on solid phase. Cleavage from the resin with 70 % TFA in dichloromethane containing 2 % water.

Image Unavailable-H-5638.0500BA

Mouse;Rat beta-Amyloid (1-40)

Supplier: Bachem Americas
Description: 1mg CAS: 144409-98-3 C190H291N51O57S FW: 4233.78 . amyloid

Image Unavailable-B-1335.0001BA

Fmoc-Gly-Osu

Supplier: Bachem Americas
Description: Sequence: Fmoc-Gly-OSu

Image Unavailable-M-2460.0005BA

Mca-Amyloid beta/A4 Protein Precursor₇₇₀ (667-676)-Lys(Dnp)-Arg-Arg amide Trifluoroacetate

Supplier: Bachem Americas
Description: This fluorescent (FRET) peptide substrate contains the wild-type amyloid precursor protein (APP) β-secretase cleavage site. Mca-SEVKMDAEFRK(Dnp)RR- amide has been used for assaying β-secretase-like activity of thimet oligopeptidase (TOP, EC 3.4.24.15). The results suggested that TOP is a potential β-secretase candidate and is involved in the processing of APP in vivo. See also L-1905.

Image Unavailable-H-3208.1000BA

Human;Mouse;Rat (Tyr³⁶)-pTH-Related Protein (1-36)

Supplier: Bachem Americas
Description: (Tyr³⁶)-pTHrP (1-36) has been used for radioiodination.

Image Unavailable-E-2975.0025BA

H-Trp(Boc)-OH

Supplier: Bachem Americas
Description: Sequence: H-Trp(Boc)-OH

Image Unavailable-H-2435.0005BA

Human;Rat CRF Acetate

Supplier: Bachem Americas
Description: CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

Image Unavailable-D-1050.0001BA

Fmoc-ε-aminocaproic acid-Wang resin 0.4-0.7 mmol/g 200-400 mesh

Supplier: Bachem Americas
Description: Sequence: Fmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
Synonym(s): Fmoc-6-aminohexanoic acid-Wang resin#Fmoc-6-aminohexanoic acid-p-alkoxybenzyl alcohol resin#Fmoc-εAhx-Wang resin#Fmoc-εAhx-p-alkoxybenzyl alcohol resin

Image Unavailable-Q-1330.0005BA

4-(2-Aminoethyl)-2-methoxyphenol hydrochloride

Supplier: Bachem Americas
Description: Sequence: 3-Methoxytyramine · HCl
Synonym(s): 3-MT · HCl#3-O-Methyldopamine · HCl

Image Unavailable-H-6674.1000BA

Human Hepcidin-25 Trifluoroacetate, Biotin

Supplier: Bachem Americas
Description: 0.5mg (Disulfide bonds between Cys7 and Cys23/Cys10 and Cys13/Cys11 and Cys19/Cys14 and Cys22) C123H184N36O33S10 FW: 3015.7 . Synonym: Biotinyl-Hepc25 (human), Biotinyl-LEAP-1 (human), Biotinyl-Liver-Expressed Antimicrobial Peptide (human), Biotinyl-PLTR (human), Biotinyl-Putative Liver Tumor Regressor (human)

SDS

Image Unavailable-F-3420.0001BA

H-L-Dap(boc)-OMe·HCl

Supplier: Bachem Americas
Description: Sequence: H-Dap(Boc)-OMe · HCl

Image Unavailable-E-1920.0005BA

H-Gln-OtBu·HCl

Supplier: Bachem Americas
Description: Sequence: H-Gln-OtBu · HCl

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
225 - 240 of 3,665
no targeter for Bottom