You Searched For: brab03


72  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"72"
Description: RAB43, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Isotype: IgG, Immunogen: RAB43 (NP-940892.1, 1 a.a. - 212 a.a) full-length human Protein, Synonym: RAB11B, Purity: Protein A purified, Application: WB, ELISA, Storage: -20C or -80C, Size: 0.1mg
Catalog Number: 103348-256
Supplier: Novus Biologicals


Catalog Number: 300050-042
Supplier: Safety & Industrial Supplies


Description: Rab13, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: RAB13 (NP-002861.1, 1 aa - 203 aa) human protein, Synonyms: Cell growth-inhibiting gene 4 protein, growth-inhibiting gene 4 protein, Rab13, Apps: WB, Storage: -20deg C, Size: 0.1 mg
Catalog Number: 103308-890
Supplier: Novus Biologicals


Description: RAB43 purified MaxPab rabbit polyclonal antibody (D01P), Rabbit polyclonal antibody raised against a full-length human RAB43 protein, Size: 100ug
Catalog Number: 10598-960
Supplier: Abnova


Description: RAB13 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 121-150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET, Synonyms: Cell growth-inhibiting gene 4 protein, RAB13, GIG4, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-436
Supplier: Boster Biological Technology


Catalog Number: 77822-164
Supplier: AFG BIOSCIENCE LLC

New Product


Catalog Number: 77822-165
Supplier: AFG BIOSCIENCE LLC

New Product


Catalog Number: ABCA_AB58030-100UG
Supplier: ABCAM INC.

New Product


Description: Rab13 Monoclonal antibody, Clone: 8H8, Host: Mouse, Species Reactivity: Human, Isotype: IgG2a Kappa, Immunogen: RAB13 (AAH00799, 1 aa - 203 aa) full-length recom protein with GST tag, Synonym: Cell growth-inhibiting gene 4 protein, Application: WB, Size: 0.1 mg
Catalog Number: 103308-892
Supplier: Novus Biologicals


Catalog Number: ABCA_AB236018-1MG
Supplier: ABCAM INC.

New Product


Catalog Number: ABCA_AB236018-100U
Supplier: ABCAM INC.

New Product


Description: RAB13 purified MaxPab rabbit polyclonal antibody (D01P), Rabbit polyclonal antibody raised against a full-length human RAB13 protein, Size: 100ug
Catalog Number: 10598-848
Supplier: Abnova


Description: RAB23 (Human) IP-WB Antibody Pair with one antibody for immunoprecipitation and another to detect the precipitated protein in western blot. Size: 1 Set
Catalog Number: 10542-068
Supplier: Abnova


Catalog Number: ABCA_AB305609-100U
Supplier: ABCAM INC.

New Product


Description: RABL3 polyclonal antibody (A01), Mouse polyclonal antibody raised against a full-length recombinant RABL3, Size: 50ul
Catalog Number: 10564-128
Supplier: Abnova


Description: RAB23 purified MaxPab mouse polyclonal antibody (B01P), Mouse polyclonal antibody raised against a full-length human RAB23 protein, Size: 50ug
Catalog Number: 10569-170
Supplier: Abnova


49 - 64 of 72