You Searched For: L-α-phosphatidylethanolamine


31  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"31"
Description: Human Rab13 monoclonal antibody (Clone 863028), Isotype: Mouse IgG2A, Immunogen: Escherichia coli-derived recombinant, Applications: Western Blot, Immunocytochemistry, 100UG
Catalog Number: 102887-596
Supplier: R&D Systems


Catalog Number: 102149-616
Supplier: Novus Biologicals


Description: RAB13, Rabbit polyclonal antibody raised against synthetic peptide of RAB13, Size: 100 ug
Catalog Number: 10730-918
Supplier: Abnova


Catalog Number: 89391-830
Supplier: Abgent


Catalog Number: 76762-874
Supplier: Prosci


Description: RAB13, Polyclonal Antibody, Host: Rabbit, Species: Human, mouse, Immunogen: immunized with a KLH conjugated synthetic peptide between 109-137 aa from the Central region, Synonyms: Ras-related protein Rab-13, Cell growth-in
Catalog Number: 76072-428
Supplier: Prosci


Description: RAB13, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Rat, Immunogen: Developed against Recombinant Protein corresponding to amino acids, Synonyms: Cell growth-inhibiting gene 4 protein, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Catalog Number: 103269-984
Supplier: Novus Biologicals


Catalog Number: 76856-158
Supplier: ANTIBODIES.COM LLC


Description: Rab13, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: RAB13 (NP-002861.1, 1 aa - 203 aa) human protein, Synonyms: Cell growth-inhibiting gene 4 protein, growth-inhibiting gene 4 protein, Rab13, Apps: WB, Storage: -20deg C, Size: 0.1 mg
Catalog Number: 103308-890
Supplier: Novus Biologicals


Description: Rab13 Monoclonal antibody, Clone: 8H8, Host: Mouse, Species Reactivity: Human, Isotype: IgG2a Kappa, Immunogen: RAB13 (AAH00799, 1 aa - 203 aa) full-length recom protein with GST tag, Synonym: Cell growth-inhibiting gene 4 protein, Application: WB, Size: 0.1 mg
Catalog Number: 103308-892
Supplier: Novus Biologicals


Description: RAB13 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 121-150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET, Synonyms: Cell growth-inhibiting gene 4 protein, RAB13, GIG4, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-436
Supplier: Boster Biological Technology


Description: RAB13 purified MaxPab rabbit polyclonal antibody (D01P), Rabbit polyclonal antibody raised against a full-length human RAB13 protein, Size: 100ug
Catalog Number: 10598-848
Supplier: Abnova


Description: RAB13 monoclonal antibody (M01), clone 8H8, Mouse monoclonal antibody raised against a full-length recombinant RAB13, Size: 100ug
Catalog Number: 10598-846
Supplier: Abnova


Catalog Number: ABCA_AB180936-100U
Supplier: ABCAM INC.

New Product


Catalog Number: ABCA_AB109958-250U
Supplier: ABCAM INC.

New Product


Catalog Number: ABCA_AB251431-100U
Supplier: ABCAM INC.

New Product


1 - 16 of 31