You Searched For: EMD MILLIPORE (BIOSCIENCES)

Description: This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Sequence: HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3692.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103007-610

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H4 (1-23) symmetrically dimethylated at Arg3 followed by a biotinylated Lys conjugated to a C-terminal GG linker. Methylation of Arg3 is catalyzed by PRMT1 and functions to promote p300 acetylation of histone H4. It has also been shown to regulate transcriptional activation of genes involved in cholesterol and bile acid homeostasis. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SG-R(Me2s)-GKGGKGLGKGGAKRHRKVLR-GGK(Biotin)
MW:2857.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-354

Supplier: Anaspec Inc

Sale

Description: Biotinylating reagent for carbohydrates and nucleic acids

Catalog Number: 103003-296

Supplier: Anaspec Inc

Sale

Description: (Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells.
Sequence:RRRRRRRRR
MW:1423.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-406

Supplier: Anaspec Inc

Sale

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm.
Sequence:5-FAM-P-Cha-G-Nva-HA-Dap(QXL™ 520)-NH2
MW:1567.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103005-936

Supplier: Anaspec Inc

Sale

Description: This peptide is a poly-gamma-D-glutamic acid (DPGA)10 construct that relates to the sequence of the Bacillus anthracis capsule which is composed of gamma DPGA. gamma DPGA is an essential virulence factor of B. anthracis. The capsule inhibits innate host defense through its antiphagocytic action. gamma DPGA is a poor immunogen, but when bound to a carrier protein, it elicits serum antibodies.

Catalog Number: 103007-710

Supplier: Anaspec Inc

Sale

Description: This sequence corresponds to the first 21 amino acids of the NH2 terminal of histone H3 followed by a GG linker and a biotinylated lysine. This peptide was used to investigate the characteristics and mechanisms of ethanol-induced histone H3 acetylation in rat hepatocytes. Immunocytochemical and immunoblot analyses revealed that ethanol treatment significantly increased H3 acetylation at Lys9 with negligible effects at Lys14, 18, and 23.
Sequence:ARTKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
MW:2723.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-912

Supplier: Anaspec Inc

Sale

Description: GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3297.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 102999-330

Supplier: Anaspec Inc

Sale

Description: This FAM labeled peptide (Abs/Em = 494/521 nm) can be used as a substrate for 5-AMP-activated protein kinase (AMPK) in in vitro kinase assays.
Sequence:5-FAM-HMRSAMSGLHLVKRR
MW:2137.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-732

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is mono-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me1)-VLRDNIQGIT-WGK(biotin)
MW:3156.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-608

Supplier: Anaspec Inc

Sale

Description: This 36-residue synthetic peptide strongly inhibits HIV-1 viral fusion with CD4 cells with an EC50 of 1 ng/ml.
It is a peptide mimetic of an essential region within the viral envelope glycoprotein gp41 that functions by blocking gp41 structural rearrangements at a transitional pre-fusion conformation.
Sequence:Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
MW:4492 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-446

Supplier: Anaspec Inc

Sale

Description: Chromogenic substrate for Kallikrein 3, commonly known as prostate specific antigen (PSA)
Sequence:Suc-RPY-pNA
MW:654.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-896

Supplier: Anaspec Inc

Sale

Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
MW: 4670.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 102999-386

Supplier: Anaspec Inc

Sale

Description: This is a peptide inhibitor of collagen fibrillar matrix assembly.
Sequence:SAGFDFSFLPQPPQEKAHDGGRYYRA
MW:2942.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-766

Supplier: Anaspec Inc

Sale

Description: An excellent amine-reactive FRET quencher paired with Trp or Tyr.

Catalog Number: 103010-916

Supplier: Anaspec Inc

Sale

Description: Q4H7 Peptide (SIIQFEHL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SIIQFEHL
MW: 986.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: 103008-066

Supplier: Anaspec Inc

Sale