Print…

You Searched For: western+blotting+equipment


155,907  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"155907"

Rate These Search Results

Product Image-10114-844

SPI1 Antibody

Description: Polyclonal, Host: Goat; Target Species: Human; Immunogen: SPI1 antibody was raised against an 11 amino acid synthetic peptide near the internal region of SPI1; Applications: ELISA,Western blotting
Catalog Number: 10114-844
Supplier: Prosci
Image Unavailable-95029-398

Tumor Human Skeletal Muscle (1 blot)

Description: Ready to Screen Western Tissue BLOTS*. 50µg sample protein and prestained marker are loaded on 4-20% denaturing polyacrylamide gel, migrated and transferred PVDF membrane. These blots are ready to be probed with antibody of choice.
Catalog Number: 95029-398
Supplier: G-Biosciences
Image Unavailable-103329-838

KIR2DL3/CD158b2 PAB 0.1 mg

Description: KIR2DL3/CD158b2 Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Conjugate: Unconjugated, Immunogen: KIR2DL3 (NP-056952.2, 1aa-341aa) full-length human protein, Synonyms: CD158b2 antigen, Application: Western blot, Storage: -20 to -80 deg C, Size: 0.1 mg
Catalog Number: 103329-838
Supplier: Novus Biologicals
Image Unavailable-16003-904

MEMBRANE 7X85CM45NTRCEL PK10

Catalog Number: 16003-904
Supplier: NuSep
Image Unavailable-16003-902

MEMBRANE 7X85CM2NTROCEL PK10

Catalog Number: 16003-902
Supplier: NuSep
Image Unavailable-16003-910

MEMBRANES 7X85CM 45PVDF PK10

Catalog Number: 16003-910
Supplier: NuSep
Product Image-RL617-106-012

Biotin Conjugated Affinity Purified anti-Monkey IgG g (gamma chain specific) (Goat)

Description: 1.0mg. Lyophilized. Antibody Concentration:1.0mg/ml (by UV absorbance at 280 nm).Buffer:0.02 M Potassium Phosphate, 0.15 M Sodium Chloride, pH 7.2. Stabilizer:10mg/ml Bovine Serum Albumin (BSA) IgG and Protease free
Catalog Number: RL617-106-012
Supplier: Rockland Immunochemical
Image Unavailable-103309-396

ROM1 Polyclonal antibody 0.05 mg

Description: ROM1, Polyclonal antibody, Host: Mouse, Species: Human, Immunogen: ROM1(1aa-351aa) full-length human protein, Synonyms: retinal outer segment membrane protein 1, rod outer segment membrane protein 1, ROM, ROSP1tspan-23, Application: Western blot, Flow, Size: 0.05 mg
Catalog Number: 103309-396
Supplier: Novus Biologicals
Image Unavailable-103328-310

HOXA1 Polyclonal antibody 0.05 mg

Description: HOXA1 Polyclonal antibody, Host: Mouse, Species: Human, Conjugate: Unconjugated, Immunogen: HOXA1 (NP-005513.1, 1 a.a. - 335 a.a.) full-length human protein, Synonyms: BSAS, homeo box A1, Application: Western blot, ICC/IF, Storage: -20 to -80 deg C, Size: 0.05 mg
Catalog Number: 103328-310
Supplier: Novus Biologicals
Product Image-RL100-401-685

ZBP-89 [Rb] Antibody

Description: Cytokine. Growth Factors. Primary Antibodies. Anti-ZBP-89 is specific for human ZBP-89. Applications include WB and ELISA. Size 100uL.
Catalog Number: RL100-401-685
Supplier: Rockland Immunochemical
Image Unavailable-103335-724

GMPS MAB 0.1mg

Description: GMPS, Monoclonal Antibody, Clone: 6B5, Host: Mouse, Species Reactivity: Human, Isotype: IgG1 Kappa, Immunogen: GMPS (NP-003866, 108 a.a. - 215 a.a.) partial recombinant protein with GST tag, Application: Western Blotting, ELISA, Storage: -20C or -80C, Size: 0.1mg
Catalog Number: 103335-724
Supplier: Novus Biologicals
Image Unavailable-103277-938

Stonin-2 PAB 100 ul

Description: Stonin-2, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Reactivity: Human, Immunogen: RTPSVTEAPPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSISSTTGKSQRDSLIVIYQDAISFDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPDDDPVAWIELDAHPPGSARSQPRDGWPMMLRIPEK, Synonyms: STN2, Application: WB, Size: 100 ul
Catalog Number: 103277-938
Supplier: Novus Biologicals
Image Unavailable-103279-942

TBLR1 Polyclonal antibody 100UL

Description: TBLR1, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: Recom Protein corresponding to amino acids, affinity purified, Synonyms: C21, Application: WB, Simple Western, ICC/IF, IHC, IHC-P, Storage: 4 C,Size: 100UL
Catalog Number: 103279-942
Supplier: Novus Biologicals
Image Unavailable-89516-244

PTEN (Center T383/T382)

Description: Polyclonal Antibody, Species Reactivity: Human, Isotype: Rabbit Ig, Gene ID: 5728, Target/Specificity: This PTEN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 361-390 amino acids from the Central region of human PTEN, 1mg
Catalog Number: 89516-244
Supplier: Abgent
Image Unavailable-89516-002

KIT (Center Y547)

Description: Polyclonal Antibody, Species Reactivity: Human, Isotype: Rabbit Ig, Gene ID: 3815, Target/Specificity: This KIT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 527-553 amino acids from the Central region of human KIT, 1mg
Catalog Number: 89516-002
Supplier: Abgent
Image Unavailable-89516-282

PTGFRN (Center)

Description: Polyclonal Antibody, Species Reactivity: Human, Mouse, Isotype: Rabbit Ig, Gene ID: 5738, Target/Specificity: This PTGFRN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 458-485 amino acids from the Central region of human PTGFRN, 1mg
Catalog Number: 89516-282
Supplier: Abgent
5,409 - 5,424 of 155,907