Print…

You Searched For: western+blotting+equipment


155,627  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"155627"

Rate These Search Results

Image Unavailable-103330-160

Lipase A Polyclonal antibody 0.1 mg

Description: Lipase A Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Conjugate: Unconjugated, Immunogen: LIPA (AAH12287.1, 1aa-399aa) full-length human protein, Synonyms: Cholesteryl esterase, Application: Western blot, Storage: -20 to -80 deg C, Size: 0.1 mg
Catalog Number: 103330-160
Supplier: Novus Biologicals
Image Unavailable-103307-764

POLR2L Polyclonal Antibody 0.1 mg

Description: POLR2L Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Unconjugated, Immunogen: POLR2L (NP_066951.1, 1 a.a. - 67 a.a.) full-length human protein, Synonyms: DNA-directed RNA polymerase III subunit L, Applications: Western blot, Size: 0.1 mg
Catalog Number: 103307-764
Supplier: Novus Biologicals
Image Unavailable-10218-042

MGMT ANTIBODY

Catalog Number: 10218-042
Supplier: Abgent
Product Image-RL600-401-B52S

Affiit Purified Anti-Prdm1/Blimp1 (Rabbit)

Description: Trial Size
Catalog Number: RL600-401-B52S
Supplier: Rockland Immunochemical
Image Unavailable-103278-448

KIAA1143 Polyclonal Antibody 100 ul

Description: KIAA1143, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: IKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVK, Synonyms: hypothetical protein LOC57456, Application: Western Blot, ICC/IF, IHC, IHC-P, Size: 100 ul
Catalog Number: 103278-448
Supplier: Novus Biologicals
Image Unavailable-103332-434

CHMP1a Polyclonal antibody 0.05 mg

Description: CHMP1a Polyclonal antibody, Host: Mouse, Reactivity: Human, Unconjugated, Immunogen: CHMP1A (N/A, 1 a.a. - 196 a.a.) full-length human protein, Synonyms: CHMP1, store at -20C or -80C, Applications: Western Blot, ICC/IF, Size: 0.05 mg
Catalog Number: 103332-434
Supplier: Novus Biologicals
Image Unavailable-103266-742

ARAP3 Polyclonal Antibody 100UL

Description: ARAP3 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Isotype: IgG, Immunogen:  developed against Recombinant Protein corresponding to amino acids, Synonym: centaurin, delta 3, Application: Western Blot, Immunohistochemistry, IHC-P, Size: 100UL
Catalog Number: 103266-742
Supplier: Novus Biologicals
Product Image-PI46425

FITC, 100 mg.

Catalog Number: PI46425
Supplier: Invitrogen

Certificates


Image Unavailable-103327-732

Uroguanylin Polyclonal Antibody 0.1 mg

Description: Uroguanylin, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: GUCA2B (NP-009033.1, 1 aa - 112 aa) full-length human protein, Synonyms: GCAP-II, guanylate cyclase activator 2B (uroguanylin), Application: Western Blot, Size: 0.1 mg
Catalog Number: 103327-732
Supplier: Novus Biologicals
Image Unavailable-103327-212

GK2 Polyclonal Antibody 0.05 mg

Description: GK2, Polyclonal Antibody, Host: Mouse, Species Reactivity: Human, Immunogen: GK2 (NP-149991.2, 1 aa - 553 aa) full-length human protein, Synonyms: EC 2.7.1.30, GK 2, GKP2, GKTAATP:glycerol 3-phosphotransferase 2, Application: Western Blot, Size: 0.05 mg
Catalog Number: 103327-212
Supplier: Novus Biologicals
Product Image-76200-230

PLATFORM ROCKER SINGLE LSE 115 V

Catalog Number: 76200-230
Supplier: Corning
Product Image-10069-526

HIV1 gp41 Antibody

Description: Polyclonal, Host: Goat, Species Reactivity: Virus, Immunogen: Recombinant (P. Pastoris) ectodomain of gp41 (glycosylated), Tested Applications: Western blotting
Catalog Number: 10069-526
Supplier: Prosci
Product Image-10069-502

Rubella virus Antibody-Biotin

Description: Polyclonal, Host: Goat, Species Reactivity: Virus, Immunogen: Specific to purified virions, Tested Applications: Western blotting
Catalog Number: 10069-502
Supplier: Prosci
Image Unavailable-RL600-401-A23

Cancer Primary Antibody Anti-Cybr [Rabbit]

Description: Tested for use in elisa, western blot (over-expressed and endogenous expected 40 kd band), and immunoprecipitation. specific conditions user optimized.
Catalog Number: RL600-401-A23
Supplier: Rockland Immunochemical
Image Unavailable-102885-962

MDMBT1, antibody

Description: Mouse DMBT1 Monoclonal antibody (Clone 548012), Isotype: Rat IgG2B, Immunogen: E. coli-derived recombinant, Application: Western Blot, 100 UG
Catalog Number: 102885-962
Supplier: R&D Systems
Product Image-10068-128

Leptin Antibody

Description: Polyclonal, Host: Chicken, Species Reactivity: Human, Immunogen: Human leptin protein, Tested Applications: ELISA, Western blotting, Immuno histochemistry, Immunocytochemistry
Catalog Number: 10068-128
Supplier: Prosci
4,081 - 4,096 of 155,627